Csa3G214590 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.AGACAATAACAATAATCTGAATCTCCACAACAAACAATTGATTGAACAACCTATTTATATTTAGAGAGATAGATAAGAAATGGGTGAGGGAATAAGAGGCTGTTCAATGGTGGGGAAAGTGGTGTTTTGTTTGTTGTTGCTGCAACAATTGAAGATGGGTTATGCAACCATTTACAATGTTGGAGAAGAGCTTGGTTGGACCTTTAATGTCTCCTCTTGGCCCATTGGAAAGAACTTTCATGCTGGAGATATTCTTGGTATTTGCCTTTTCTTTTCTGAATTTTCATGGCATTGGATCATAATTGGTGTTGACTGTTTAATGTCTTCCATGTTAATTTAAAGAAATAAATTTACTTATAAATATATAGTATTAAAAGCATTGTTAATTAATTTGTATGTTTAAAAAATGCAGCATTCAGCTACAACCCGTCGATGCACAATGTGGTAGTAGTTGACAAAGTGGGTTACAATTGGTGTTTGACCCATCCGATAGAAGCAACTGTTCATCGTTCAGGAAAGGATCAAATCAAGCTTGTTGAGGGCATGAATTATTATATCTGCAGCCGTCCTGGCCATTGTCAAATGGGAATGAAACTTGCTATTAATGCTACTTCTTGA ATGGGTGAGGGAATAAGAGGCTGTTCAATGGTGGGGAAAGTGGTGTTTTGTTTGTTGTTGCTGCAACAATTGAAGATGGGTTATGCAACCATTTACAATGTTGGAGAAGAGCTTGGTTGGACCTTTAATGTCTCCTCTTGGCCCATTGGAAAGAACTTTCATGCTGGAGATATTCTTGCATTCAGCTACAACCCGTCGATGCACAATGTGGTAGTAGTTGACAAAGTGGGTTACAATTGGTGTTTGACCCATCCGATAGAAGCAACTGTTCATCGTTCAGGAAAGGATCAAATCAAGCTTGTTGAGGGCATGAATTATTATATCTGCAGCCGTCCTGGCCATTGTCAAATGGGAATGAAACTTGCTATTAATGCTACTTCTTGA ATGGGTGAGGGAATAAGAGGCTGTTCAATGGTGGGGAAAGTGGTGTTTTGTTTGTTGTTGCTGCAACAATTGAAGATGGGTTATGCAACCATTTACAATGTTGGAGAAGAGCTTGGTTGGACCTTTAATGTCTCCTCTTGGCCCATTGGAAAGAACTTTCATGCTGGAGATATTCTTGCATTCAGCTACAACCCGTCGATGCACAATGTGGTAGTAGTTGACAAAGTGGGTTACAATTGGTGTTTGACCCATCCGATAGAAGCAACTGTTCATCGTTCAGGAAAGGATCAAATCAAGCTTGTTGAGGGCATGAATTATTATATCTGCAGCCGTCCTGGCCATTGTCAAATGGGAATGAAACTTGCTATTAATGCTACTTCTTGA MGEGIRGCSMVGKVVFCLLLLQQLKMGYATIYNVGEELGWTFNVSSWPIGKNFHAGDILAFSYNPSMHNVVVVDKVGYNWCLTHPIEATVHRSGKDQIKLVEGMNYYICSRPGHCQMGMKLAINATS*
BLAST of Csa3G214590 vs. Swiss-Prot
Match: BABL_CUCSA (Basic blue protein OS=Cucumis sativus PE=1 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 3.1e-28 Identity = 58/95 (61.05%), Postives = 70/95 (73.68%), Query Frame = 1
BLAST of Csa3G214590 vs. Swiss-Prot
Match: BABL_LILLO (Chemocyanin OS=Lilium longiflorum PE=1 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 7.1e-25 Identity = 53/111 (47.75%), Postives = 68/111 (61.26%), Query Frame = 1
BLAST of Csa3G214590 vs. Swiss-Prot
Match: BABL_ARATH (Basic blue protein OS=Arabidopsis thaliana GN=ARPN PE=2 SV=2) HSP 1 Score: 112.1 bits (279), Expect = 4.6e-24 Identity = 58/129 (44.96%), Postives = 73/129 (56.59%), Query Frame = 1
BLAST of Csa3G214590 vs. Swiss-Prot
Match: MAVI_CUCPE (Mavicyanin OS=Cucurbita pepo PE=1 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.6e-13 Identity = 39/100 (39.00%), Postives = 54/100 (54.00%), Query Frame = 1
BLAST of Csa3G214590 vs. Swiss-Prot
Match: LAML_ARATH (Lamin-like protein OS=Arabidopsis thaliana GN=At5g15350 PE=1 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.5e-11 Identity = 38/117 (32.48%), Postives = 59/117 (50.43%), Query Frame = 1
BLAST of Csa3G214590 vs. TrEMBL
Match: A0A0A0L6J3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G214590 PE=4 SV=1) HSP 1 Score: 271.6 bits (693), Expect = 5.1e-70 Identity = 127/127 (100.00%), Postives = 127/127 (100.00%), Query Frame = 1
BLAST of Csa3G214590 vs. TrEMBL
Match: A0A0A0LC13_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G215590 PE=4 SV=1) HSP 1 Score: 147.5 bits (371), Expect = 1.1e-32 Identity = 73/126 (57.94%), Postives = 95/126 (75.40%), Query Frame = 1
BLAST of Csa3G214590 vs. TrEMBL
Match: M5VJM1_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa018507mg PE=4 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 1.0e-30 Identity = 70/125 (56.00%), Postives = 86/125 (68.80%), Query Frame = 1
BLAST of Csa3G214590 vs. TrEMBL
Match: B9GEY2_POPTR (Basic blue copper family protein OS=Populus trichocarpa GN=POPTR_0001s21660g PE=4 SV=1) HSP 1 Score: 137.1 bits (344), Expect = 1.5e-29 Identity = 70/122 (57.38%), Postives = 86/122 (70.49%), Query Frame = 1
BLAST of Csa3G214590 vs. TrEMBL
Match: W9SBG7_9ROSA (Basic blue protein OS=Morus notabilis GN=L484_024185 PE=4 SV=1) HSP 1 Score: 137.1 bits (344), Expect = 1.5e-29 Identity = 66/125 (52.80%), Postives = 83/125 (66.40%), Query Frame = 1
BLAST of Csa3G214590 vs. TAIR10
Match: AT2G02850.1 (AT2G02850.1 plantacyanin) HSP 1 Score: 112.1 bits (279), Expect = 2.6e-25 Identity = 58/129 (44.96%), Postives = 73/129 (56.59%), Query Frame = 1
BLAST of Csa3G214590 vs. TAIR10
Match: AT3G60270.1 (AT3G60270.1 Cupredoxin superfamily protein) HSP 1 Score: 77.0 bits (188), Expect = 9.2e-15 Identity = 46/119 (38.66%), Postives = 62/119 (52.10%), Query Frame = 1
BLAST of Csa3G214590 vs. TAIR10
Match: AT1G17800.1 (AT1G17800.1 early nodulin-like protein 22) HSP 1 Score: 72.4 bits (176), Expect = 2.3e-13 Identity = 44/115 (38.26%), Postives = 61/115 (53.04%), Query Frame = 1
BLAST of Csa3G214590 vs. TAIR10
Match: AT5G15350.1 (AT5G15350.1 early nodulin-like protein 17) HSP 1 Score: 70.5 bits (171), Expect = 8.6e-13 Identity = 38/117 (32.48%), Postives = 59/117 (50.43%), Query Frame = 1
BLAST of Csa3G214590 vs. TAIR10
Match: AT4G12880.1 (AT4G12880.1 early nodulin-like protein 19) HSP 1 Score: 67.0 bits (162), Expect = 9.6e-12 Identity = 38/121 (31.40%), Postives = 58/121 (47.93%), Query Frame = 1
BLAST of Csa3G214590 vs. NCBI nr
Match: gi|449464514|ref|XP_004149974.1| (PREDICTED: basic blue protein-like [Cucumis sativus]) HSP 1 Score: 271.6 bits (693), Expect = 7.2e-70 Identity = 127/127 (100.00%), Postives = 127/127 (100.00%), Query Frame = 1
BLAST of Csa3G214590 vs. NCBI nr
Match: gi|659112156|ref|XP_008456091.1| (PREDICTED: basic blue protein-like [Cucumis melo]) HSP 1 Score: 243.4 bits (620), Expect = 2.1e-61 Identity = 113/127 (88.98%), Postives = 118/127 (92.91%), Query Frame = 1
BLAST of Csa3G214590 vs. NCBI nr
Match: gi|659131262|ref|XP_008465594.1| (PREDICTED: basic blue protein-like [Cucumis melo]) HSP 1 Score: 148.7 bits (374), Expect = 7.1e-33 Identity = 74/126 (58.73%), Postives = 95/126 (75.40%), Query Frame = 1
BLAST of Csa3G214590 vs. NCBI nr
Match: gi|449464494|ref|XP_004149964.1| (PREDICTED: basic blue protein-like [Cucumis sativus]) HSP 1 Score: 147.5 bits (371), Expect = 1.6e-32 Identity = 73/126 (57.94%), Postives = 95/126 (75.40%), Query Frame = 1
BLAST of Csa3G214590 vs. NCBI nr
Match: gi|595792743|ref|XP_007200120.1| (hypothetical protein PRUPE_ppa018507mg [Prunus persica]) HSP 1 Score: 141.0 bits (354), Expect = 1.5e-30 Identity = 70/125 (56.00%), Postives = 86/125 (68.80%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |