Csa3G171110 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCAAGGCACTGCAAGTATGTCCAAATAGTGGCATATTGCGGGAAGCCTGAATAGAGATGGTACCTTGCCCATGATGTAAAACCAAGACCATTGTTGCACTTAACAAATGTGATCATGATACTCACCTTATTGCTGCTGTGGCCAAGTTGTTTTGGCATTACAGGAAGGTTGACATTGCTAGAACTTGGCTGAACAGGGCAGTAATTCTTGCTTCAGGTGTTGGTGTTTTTACTACAAATTCAAACTTCAGCAGGGTACTGACGAGAATCAGAAGAAACGTACTGAAGAGATATGTTGATGCAGAACCCAAACAGTTGCGAAATGGCAAACAATTTCAAAGGCTGAGGAGAACTTCCATCAAACGACTGAAGCAATCTTGA ATGGCCAAGGCACTGCAAACCATTGTTGCACTTAACAAATGTGATCATGATACTCACCTTATTGCTGCTGTGGCCAAGTTGTTTTGGCATTACAGGAAGGTTGACATTGCTAGAACTTGGCTGAACAGGGCAGTAATTCTTGCTTCAGGTGTTGGTGTTTTTACTACAAATTCAAACTTCAGCAGGGTACTGACGAGAATCAGAAGAAACGTACTGAAGAGATATGTTGATGCAGAACCCAAACAGTTGCGAAATGGCAAACAATTTCAAAGGCTGAGGAGAACTTCCATCAAACGACTGAAGCAATCTTGA ATGGCCAAGGCACTGCAAACCATTGTTGCACTTAACAAATGTGATCATGATACTCACCTTATTGCTGCTGTGGCCAAGTTGTTTTGGCATTACAGGAAGGTTGACATTGCTAGAACTTGGCTGAACAGGGCAGTAATTCTTGCTTCAGGTGTTGGTGTTTTTACTACAAATTCAAACTTCAGCAGGGTACTGACGAGAATCAGAAGAAACGTACTGAAGAGATATGTTGATGCAGAACCCAAACAGTTGCGAAATGGCAAACAATTTCAAAGGCTGAGGAGAACTTCCATCAAACGACTGAAGCAATCTTGA MAKALQTIVALNKCDHDTHLIAAVAKLFWHYRKVDIARTWLNRAVILASGVGVFTTNSNFSRVLTRIRRNVLKRYVDAEPKQLRNGKQFQRLRRTSIKRLKQS*
BLAST of Csa3G171110 vs. Swiss-Prot
Match: PRP6_BOVIN (Pre-mRNA-processing factor 6 OS=Bos taurus GN=PRPF6 PE=2 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.4e-07 Identity = 30/79 (37.97%), Postives = 41/79 (51.90%), Query Frame = 1
BLAST of Csa3G171110 vs. Swiss-Prot
Match: PRP6_HUMAN (Pre-mRNA-processing factor 6 OS=Homo sapiens GN=PRPF6 PE=1 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.9e-07 Identity = 30/79 (37.97%), Postives = 40/79 (50.63%), Query Frame = 1
BLAST of Csa3G171110 vs. Swiss-Prot
Match: PRP6_PONAB (Pre-mRNA-processing factor 6 OS=Pongo abelii GN=PRPF6 PE=2 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.9e-07 Identity = 30/79 (37.97%), Postives = 40/79 (50.63%), Query Frame = 1
BLAST of Csa3G171110 vs. Swiss-Prot
Match: PRP6_MOUSE (Pre-mRNA-processing factor 6 OS=Mus musculus GN=Prpf6 PE=1 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.9e-07 Identity = 30/79 (37.97%), Postives = 41/79 (51.90%), Query Frame = 1
BLAST of Csa3G171110 vs. Swiss-Prot
Match: PRP6_RAT (Pre-mRNA-processing factor 6 OS=Rattus norvegicus GN=Prpf6 PE=1 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.9e-07 Identity = 30/79 (37.97%), Postives = 41/79 (51.90%), Query Frame = 1
BLAST of Csa3G171110 vs. TrEMBL
Match: A0A0A0L5Z8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G171110 PE=4 SV=1) HSP 1 Score: 205.7 bits (522), Expect = 2.8e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 1
BLAST of Csa3G171110 vs. TrEMBL
Match: B9RW28_RICCO (Pre-mRNA splicing factor, putative OS=Ricinus communis GN=RCOM_1175540 PE=4 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 1.6e-13 Identity = 46/88 (52.27%), Postives = 57/88 (64.77%), Query Frame = 1
BLAST of Csa3G171110 vs. TrEMBL
Match: A0A151SF39_CAJCA (Pre-mRNA-processing factor 6 OS=Cajanus cajan GN=KK1_024785 PE=4 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 3.5e-13 Identity = 45/88 (51.14%), Postives = 57/88 (64.77%), Query Frame = 1
BLAST of Csa3G171110 vs. TrEMBL
Match: V7BV27_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_005G104900g PE=4 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 3.5e-13 Identity = 44/92 (47.83%), Postives = 60/92 (65.22%), Query Frame = 1
BLAST of Csa3G171110 vs. TrEMBL
Match: A0A0S3SHG8_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.07G096300 PE=4 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 4.6e-13 Identity = 44/88 (50.00%), Postives = 58/88 (65.91%), Query Frame = 1
BLAST of Csa3G171110 vs. TAIR10
Match: AT4G03430.1 (AT4G03430.1 pre-mRNA splicing factor-related) HSP 1 Score: 56.6 bits (135), Expect = 1.1e-08 Identity = 32/92 (34.78%), Postives = 47/92 (51.09%), Query Frame = 1
BLAST of Csa3G171110 vs. NCBI nr
Match: gi|700202070|gb|KGN57203.1| (hypothetical protein Csa_3G171110 [Cucumis sativus]) HSP 1 Score: 205.7 bits (522), Expect = 4.0e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 1
BLAST of Csa3G171110 vs. NCBI nr
Match: gi|255553813|ref|XP_002517947.1| (PREDICTED: protein STABILIZED1 [Ricinus communis]) HSP 1 Score: 83.6 bits (205), Expect = 2.3e-13 Identity = 46/88 (52.27%), Postives = 57/88 (64.77%), Query Frame = 1
BLAST of Csa3G171110 vs. NCBI nr
Match: gi|1021494471|ref|XP_016190229.1| (PREDICTED: protein STABILIZED1 [Arachis ipaensis]) HSP 1 Score: 83.2 bits (204), Expect = 3.0e-13 Identity = 46/88 (52.27%), Postives = 57/88 (64.77%), Query Frame = 1
BLAST of Csa3G171110 vs. NCBI nr
Match: gi|1012099983|ref|XP_015957103.1| (PREDICTED: protein STABILIZED1 [Arachis duranensis]) HSP 1 Score: 83.2 bits (204), Expect = 3.0e-13 Identity = 46/88 (52.27%), Postives = 57/88 (64.77%), Query Frame = 1
BLAST of Csa3G171110 vs. NCBI nr
Match: gi|951072544|ref|XP_014491759.1| (PREDICTED: protein STABILIZED1 [Vigna radiata var. radiata]) HSP 1 Score: 82.8 bits (203), Expect = 3.9e-13 Identity = 44/92 (47.83%), Postives = 60/92 (65.22%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|