Csa3G169510 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACAGCTGTGATCGTTTTTTAGACTTTCTGAGGAGGAGTAATGAAGTTAGCCCCACTGTTGCACTGGAAACCGCAACAGCTTTGCAGGTGATATTGTCTAATAACTTTCCACTGTTATTTTTTGAACTAAACTTATAGTACTTTATCCAAAGTGCAGGTAAAATTTGAGAAAGTGACTCGTAGAGCGCAAGAGCAATTTCAGACTGCATTAGAGGAACAGAGCAGGTAA ATGGACAGCTGTGATCGTTTTTTAGACTTTCTGAGGAGGAGTAATGAAGTTAGCCCCACTGTTGCACTGGAAACCGCAACAGCTTTGCAGGTAAAATTTGAGAAAGTGACTCGTAGAGCGCAAGAGCAATTTCAGACTGCATTAGAGGAACAGAGCAGGTAA ATGGACAGCTGTGATCGTTTTTTAGACTTTCTGAGGAGGAGTAATGAAGTTAGCCCCACTGTTGCACTGGAAACCGCAACAGCTTTGCAGGTAAAATTTGAGAAAGTGACTCGTAGAGCGCAAGAGCAATTTCAGACTGCATTAGAGGAACAGAGCAGGTAA MDSCDRFLDFLRRSNEVSPTVALETATALQVKFEKVTRRAQEQFQTALEEQSR*
BLAST of Csa3G169510 vs. TrEMBL
Match: A0A0A0LAT3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G169510 PE=4 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 2.6e-20 Identity = 53/53 (100.00%), Postives = 53/53 (100.00%), Query Frame = 1
BLAST of Csa3G169510 vs. TrEMBL
Match: A0A061EP79_THECC (Calcium-dependent lipid-binding family protein isoform 1 OS=Theobroma cacao GN=TCM_021446 PE=4 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 8.8e-16 Identity = 44/52 (84.62%), Postives = 47/52 (90.38%), Query Frame = 1
BLAST of Csa3G169510 vs. TrEMBL
Match: A0A061EQ98_THECC (Calcium-dependent lipid-binding family protein isoform 4 OS=Theobroma cacao GN=TCM_021446 PE=4 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 8.8e-16 Identity = 44/52 (84.62%), Postives = 47/52 (90.38%), Query Frame = 1
BLAST of Csa3G169510 vs. TrEMBL
Match: A0A061EPR6_THECC (Calcium-dependent lipid-binding family protein isoform 2 (Fragment) OS=Theobroma cacao GN=TCM_021446 PE=4 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 8.8e-16 Identity = 44/52 (84.62%), Postives = 47/52 (90.38%), Query Frame = 1
BLAST of Csa3G169510 vs. TrEMBL
Match: A0A061EX48_THECC (Calcium-dependent lipid-binding family protein isoform 3 OS=Theobroma cacao GN=TCM_021446 PE=4 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 8.8e-16 Identity = 44/52 (84.62%), Postives = 47/52 (90.38%), Query Frame = 1
BLAST of Csa3G169510 vs. TAIR10
Match: AT1G48090.1 (AT1G48090.1 calcium-dependent lipid-binding family protein) HSP 1 Score: 73.9 bits (180), Expect = 3.3e-14 Identity = 37/52 (71.15%), Postives = 41/52 (78.85%), Query Frame = 1
BLAST of Csa3G169510 vs. TAIR10
Match: AT4G17140.3 (AT4G17140.3 pleckstrin homology (PH) domain-containing protein) HSP 1 Score: 46.2 bits (108), Expect = 7.4e-06 Identity = 24/52 (46.15%), Postives = 30/52 (57.69%), Query Frame = 1
BLAST of Csa3G169510 vs. NCBI nr
Match: gi|778679130|ref|XP_011651092.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101213129 [Cucumis sativus]) HSP 1 Score: 105.1 bits (261), Expect = 3.8e-20 Identity = 53/53 (100.00%), Postives = 53/53 (100.00%), Query Frame = 1
BLAST of Csa3G169510 vs. NCBI nr
Match: gi|700202058|gb|KGN57191.1| (hypothetical protein Csa_3G169510 [Cucumis sativus]) HSP 1 Score: 105.1 bits (261), Expect = 3.8e-20 Identity = 53/53 (100.00%), Postives = 53/53 (100.00%), Query Frame = 1
BLAST of Csa3G169510 vs. NCBI nr
Match: gi|659077001|ref|XP_008438979.1| (PREDICTED: uncharacterized protein LOC103483912 [Cucumis melo]) HSP 1 Score: 101.7 bits (252), Expect = 4.2e-19 Identity = 51/53 (96.23%), Postives = 52/53 (98.11%), Query Frame = 1
BLAST of Csa3G169510 vs. NCBI nr
Match: gi|590662315|ref|XP_007035914.1| (Calcium-dependent lipid-binding family protein isoform 1 [Theobroma cacao]) HSP 1 Score: 90.1 bits (222), Expect = 1.3e-15 Identity = 44/52 (84.62%), Postives = 47/52 (90.38%), Query Frame = 1
BLAST of Csa3G169510 vs. NCBI nr
Match: gi|1009172183|ref|XP_015867133.1| (PREDICTED: uncharacterized protein LOC107404665 [Ziziphus jujuba]) HSP 1 Score: 90.1 bits (222), Expect = 1.3e-15 Identity = 44/53 (83.02%), Postives = 49/53 (92.45%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|