Csa3G141900 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.GAAAGAGTCTTTCACATCCATACATATATATACCTAACCTTCAACATGGCTGAAGAATCTGCTCAAAGTAAGTCCCTTATATACATTGATCACCCTATCAACTTGCTTTAAATTTTTCAAAAGTATTTGTTCCAAAGTAGTTTTTAATTTCGAAACAATCTTCTTTTTGAAAAACGACTAGTTTCGATTAAATATATGATCTGTAAACTAACATGAAATTTGATCAACTATCACAAAGTATTGGAAGTCAAATCAATTAATCAATACACACACAAAAACAATATCCCTATAACTGTGTATATTAATTTTATCAATTATCACAACTATTTTATGTTCGGTAGGATTGGACTTTATTCAATTTGAAGTTTTGTATATTTTGTGTTCGTTTATTTATGTAATTTTGAGTTATATTCTATCAAGGGTATACTTCGGTTGAATTTTAGATTAATCTATATGCAAAATTTAACATATACTCAATATATAATTCTTAAATAGGAAAAACTCGATGGCCAGAGCTTGTGTTCGTAAATTTTTGTACTGCTGCTAGGATAATAGAAAAAGAGAATCCTGACGTGAAGGCTATCAAGATTCTGGTTGATAGTCCCAGAATTCAGAATTTTGATATTAGCCGAGTTTGGGTTGATTGCAATATAGAAGAAAGAGTTGTTAAAGTGCCCAGCGTTGGTTAAATATTGGGTGATGTGTATAAGGTCAATATGTATAATGTCTATGCATATGTCTAA ATGGCTGAAGAATCTGCTCAAAGAAAAACTCGATGGCCAGAGCTTGTGTTCGTAAATTTTTGTACTGCTGCTAGGATAATAGAAAAAGAGAATCCTGACGTGAAGGCTATCAAGATTCTGGTTGATAGTCCCAGAATTCAGAATTTTGATATTAGCCGAGTTTGGGTTGATTGCAATATAGAAGAAAGAGTTGTTAAAGTGCCCAGCGTTGGTTAA ATGGCTGAAGAATCTGCTCAAAGAAAAACTCGATGGCCAGAGCTTGTGTTCGTAAATTTTTGTACTGCTGCTAGGATAATAGAAAAAGAGAATCCTGACGTGAAGGCTATCAAGATTCTGGTTGATAGTCCCAGAATTCAGAATTTTGATATTAGCCGAGTTTGGGTTGATTGCAATATAGAAGAAAGAGTTGTTAAAGTGCCCAGCGTTGGTTAA MAEESAQRKTRWPELVFVNFCTAARIIEKENPDVKAIKILVDSPRIQNFDISRVWVDCNIEERVVKVPSVG*
BLAST of Csa3G141900 vs. TrEMBL
Match: A0A0A0L785_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G141900 PE=4 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 1.8e-32 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 1
BLAST of Csa3G141900 vs. TrEMBL
Match: A0A0A0L8E6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G142910 PE=4 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.2e-20 Identity = 52/71 (73.24%), Postives = 58/71 (81.69%), Query Frame = 1
BLAST of Csa3G141900 vs. TrEMBL
Match: A0A0A0L9Z4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G142410 PE=4 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 3.4e-15 Identity = 44/71 (61.97%), Postives = 53/71 (74.65%), Query Frame = 1
BLAST of Csa3G141900 vs. TrEMBL
Match: A0A0A0L4I0_CUCSA (Protease inhibitor protein OS=Cucumis sativus GN=Csa_3G142400 PE=4 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 5.4e-13 Identity = 42/71 (59.15%), Postives = 52/71 (73.24%), Query Frame = 1
BLAST of Csa3G141900 vs. TrEMBL
Match: A0A0K9RN96_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_047410 PE=4 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 3.8e-06 Identity = 30/63 (47.62%), Postives = 40/63 (63.49%), Query Frame = 1
BLAST of Csa3G141900 vs. TAIR10
Match: AT3G46860.1 (AT3G46860.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 49.3 bits (116), Expect = 1.2e-06 Identity = 27/64 (42.19%), Postives = 34/64 (53.12%), Query Frame = 1
BLAST of Csa3G141900 vs. TAIR10
Match: AT2G38870.1 (AT2G38870.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 47.0 bits (110), Expect = 5.8e-06 Identity = 29/64 (45.31%), Postives = 31/64 (48.44%), Query Frame = 1
BLAST of Csa3G141900 vs. NCBI nr
Match: gi|700201761|gb|KGN56894.1| (hypothetical protein Csa_3G141900 [Cucumis sativus]) HSP 1 Score: 146.0 bits (367), Expect = 2.6e-32 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 1
BLAST of Csa3G141900 vs. NCBI nr
Match: gi|700201764|gb|KGN56897.1| (hypothetical protein Csa_3G142910 [Cucumis sativus]) HSP 1 Score: 106.7 bits (265), Expect = 1.7e-20 Identity = 52/71 (73.24%), Postives = 58/71 (81.69%), Query Frame = 1
BLAST of Csa3G141900 vs. NCBI nr
Match: gi|700201763|gb|KGN56896.1| (hypothetical protein Csa_3G142410 [Cucumis sativus]) HSP 1 Score: 88.6 bits (218), Expect = 4.9e-15 Identity = 44/71 (61.97%), Postives = 53/71 (74.65%), Query Frame = 1
BLAST of Csa3G141900 vs. NCBI nr
Match: gi|700201762|gb|KGN56895.1| (Protease inhibitor protein [Cucumis sativus]) HSP 1 Score: 81.3 bits (199), Expect = 7.8e-13 Identity = 42/71 (59.15%), Postives = 52/71 (73.24%), Query Frame = 1
BLAST of Csa3G141900 vs. NCBI nr
Match: gi|902228141|gb|KNA20990.1| (hypothetical protein SOVF_047410 [Spinacia oleracea]) HSP 1 Score: 58.5 bits (140), Expect = 5.4e-06 Identity = 30/63 (47.62%), Postives = 40/63 (63.49%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |