Csa3G131900 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGGCGCATTAAACATCCACACATCTTCCAAACACGTGTAAGTATGTTTTCTAAATAATATGCGTATAATATATACATGTTTGTCTATTGATTTTGTTAGGATGGTTTGCCCAAGAAAGTGGATTGGGTTGAGAGCGCTGCTGTTACTCCGCCAAGAGATCAAGGACCCTCTCCAACTTGTAGGGCATATAGTGGAGTAGCAGCAATAGAATCGATGAATAAAATAAAAAGAGGGCAATTAGTTAACCTGACCGTTGTTGATGTTATTATTGACAACATACGGTTTTGGATGGATGGAGCATGGCCGGACGTTGTATTTCACGATGGAGTAAAGTAA ATGTGGCGCATTAAACATCCACACATCTTCCAAACACGTGATGGTTTGCCCAAGAAAGTGGATTGGGTTGAGAGCGCTGCTGTTACTCCGCCAAGAGATCAAGGACCCTCTCCAACTTGTAGGGCATATAGTGGAGTAGCAGCAATAGAATCGATGAATAAAATAAAAAGAGGGCAATTAGTTAACCTGACCGTTGTTGATGTTATTATTGACAACATACGGTTTTGGATGGATGGAGCATGGCCGGACGTTGTATTTCACGATGGAGTAAAGTAA ATGTGGCGCATTAAACATCCACACATCTTCCAAACACGTGATGGTTTGCCCAAGAAAGTGGATTGGGTTGAGAGCGCTGCTGTTACTCCGCCAAGAGATCAAGGACCCTCTCCAACTTGTAGGGCATATAGTGGAGTAGCAGCAATAGAATCGATGAATAAAATAAAAAGAGGGCAATTAGTTAACCTGACCGTTGTTGATGTTATTATTGACAACATACGGTTTTGGATGGATGGAGCATGGCCGGACGTTGTATTTCACGATGGAGTAAAGTAA MWRIKHPHIFQTRDGLPKKVDWVESAAVTPPRDQGPSPTCRAYSGVAAIESMNKIKRGQLVNLTVVDVIIDNIRFWMDGAWPDVVFHDGVK*
BLAST of Csa3G131900 vs. Swiss-Prot
Match: RDL5_ARATH (Probable cysteine protease RDL5 OS=Arabidopsis thaliana GN=RDL5 PE=2 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 7.4e-08 Identity = 30/62 (48.39%), Postives = 38/62 (61.29%), Query Frame = 1
BLAST of Csa3G131900 vs. Swiss-Prot
Match: RD21C_ARATH (Probable cysteine protease RD21C OS=Arabidopsis thaliana GN=RD21C PE=1 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 9.7e-08 Identity = 22/62 (35.48%), Postives = 39/62 (62.90%), Query Frame = 1
BLAST of Csa3G131900 vs. Swiss-Prot
Match: RDL4_ARATH (Probable cysteine protease RDL4 OS=Arabidopsis thaliana GN=RDL4 PE=2 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.3e-07 Identity = 31/71 (43.66%), Postives = 38/71 (53.52%), Query Frame = 1
BLAST of Csa3G131900 vs. Swiss-Prot
Match: ANAN_ANACO (Ananain OS=Ananas comosus GN=AN1 PE=1 SV=2) HSP 1 Score: 56.6 bits (135), Expect = 1.6e-07 Identity = 25/66 (37.88%), Postives = 40/66 (60.61%), Query Frame = 1
BLAST of Csa3G131900 vs. Swiss-Prot
Match: PAPA3_CARPA (Caricain OS=Carica papaya PE=1 SV=2) HSP 1 Score: 55.8 bits (133), Expect = 2.8e-07 Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 1
BLAST of Csa3G131900 vs. TrEMBL
Match: A0A0A0L7Y4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G131900 PE=4 SV=1) HSP 1 Score: 196.1 bits (497), Expect = 1.9e-47 Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 1
BLAST of Csa3G131900 vs. TrEMBL
Match: A0A0D3A5L6_BRAOL (Uncharacterized protein OS=Brassica oleracea var. oleracea PE=3 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.5e-07 Identity = 29/62 (46.77%), Postives = 42/62 (67.74%), Query Frame = 1
BLAST of Csa3G131900 vs. TrEMBL
Match: B9SGM8_RICCO (Cysteine protease, putative OS=Ricinus communis GN=RCOM_0554360 PE=3 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 2.0e-07 Identity = 29/62 (46.77%), Postives = 42/62 (67.74%), Query Frame = 1
BLAST of Csa3G131900 vs. TrEMBL
Match: R0H3G6_9BRAS (Uncharacterized protein OS=Capsella rubella GN=CARUB_v10006494mg PE=3 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 2.6e-07 Identity = 32/73 (43.84%), Postives = 48/73 (65.75%), Query Frame = 1
BLAST of Csa3G131900 vs. TrEMBL
Match: K4BG42_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=3 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 4.4e-07 Identity = 30/74 (40.54%), Postives = 47/74 (63.51%), Query Frame = 1
BLAST of Csa3G131900 vs. TAIR10
Match: AT4G11320.1 (AT4G11320.1 Papain family cysteine protease) HSP 1 Score: 57.8 bits (138), Expect = 4.2e-09 Identity = 30/62 (48.39%), Postives = 38/62 (61.29%), Query Frame = 1
BLAST of Csa3G131900 vs. TAIR10
Match: AT3G19390.1 (AT3G19390.1 Granulin repeat cysteine protease family protein) HSP 1 Score: 57.4 bits (137), Expect = 5.4e-09 Identity = 22/62 (35.48%), Postives = 39/62 (62.90%), Query Frame = 1
BLAST of Csa3G131900 vs. TAIR10
Match: AT4G11310.1 (AT4G11310.1 Papain family cysteine protease) HSP 1 Score: 57.0 bits (136), Expect = 7.1e-09 Identity = 31/71 (43.66%), Postives = 38/71 (53.52%), Query Frame = 1
BLAST of Csa3G131900 vs. TAIR10
Match: AT4G23520.1 (AT4G23520.1 Cysteine proteinases superfamily protein) HSP 1 Score: 55.1 bits (131), Expect = 2.7e-08 Identity = 25/60 (41.67%), Postives = 39/60 (65.00%), Query Frame = 1
BLAST of Csa3G131900 vs. TAIR10
Match: AT1G06260.1 (AT1G06260.1 Cysteine proteinases superfamily protein) HSP 1 Score: 54.7 bits (130), Expect = 3.5e-08 Identity = 28/54 (51.85%), Postives = 33/54 (61.11%), Query Frame = 1
BLAST of Csa3G131900 vs. NCBI nr
Match: gi|700201604|gb|KGN56737.1| (hypothetical protein Csa_3G131900 [Cucumis sativus]) HSP 1 Score: 196.1 bits (497), Expect = 2.8e-47 Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 1
BLAST of Csa3G131900 vs. NCBI nr
Match: gi|778688440|ref|XP_011652750.1| (PREDICTED: ananain-like [Cucumis sativus]) HSP 1 Score: 167.2 bits (422), Expect = 1.4e-38 Identity = 79/82 (96.34%), Postives = 79/82 (96.34%), Query Frame = 1
BLAST of Csa3G131900 vs. NCBI nr
Match: gi|922414518|ref|XP_013590665.1| (PREDICTED: zingipain-2 [Brassica oleracea var. oleracea]) HSP 1 Score: 63.5 bits (153), Expect = 2.2e-07 Identity = 29/62 (46.77%), Postives = 42/62 (67.74%), Query Frame = 1
BLAST of Csa3G131900 vs. NCBI nr
Match: gi|802640836|ref|XP_012079031.1| (PREDICTED: ervatamin-B [Jatropha curcas]) HSP 1 Score: 63.5 bits (153), Expect = 2.2e-07 Identity = 30/67 (44.78%), Postives = 43/67 (64.18%), Query Frame = 1
BLAST of Csa3G131900 vs. NCBI nr
Match: gi|970015214|ref|XP_015068628.1| (PREDICTED: cysteine proteinase COT44-like [Solanum pennellii]) HSP 1 Score: 63.2 bits (152), Expect = 2.8e-07 Identity = 29/74 (39.19%), Postives = 48/74 (64.86%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |