Csa3G122510 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGATTGGAAGAGGGAAGAGGGAAGAGGGAAGAGGGAGTTTTGGAAGACCCACAAGGGAACAGTGGTGAAGGCCTGGTCTTGTCATGGTATGTCCCGTACTCTGTATGTCATTTTCATCATAATAAATGCGTCTCAAATCTCTCTCTGTTCAATAAATGCTCGTCTGCATTGTGAGAATCCGCAATAAATTCTTCTCCTTATTCGCTTATTTCTTATATCAGTTGTGCGTAATTGTAAAACCTCAGAATAAGAAACCTCTGCATTAACTCCCTCAATTTTTTTGGACAAATTTTACTTTCAATGATGATTCAATTCTTACTATGCTCAACCATGTCAGTATTTATTGCAAGAACCAGCTTGAAACTAGCTGATCCTTGTCCTTCCCATTCAGACTCACATAGCCATTAATTTCCCTCTTCTCATTTCAATTCATTGAGATAACCCCTTCACATGGCTTTCCTCATCCATTTGTGAATTCGCTCTAAGAAATTGATGTGCTAAGAAAGGATCTGGATTTTGTTCTTTCACTCTTGGCCACTTGAAGGAGTGTCTCTGCCTCTGGTAGTGAAAGCTGTGAGATGGGGAGGACACCTTGTTGTGATAAGAAGGGGCTAAAGAAAGGGCCGTGGACATCGGAAGAAGATGAACTCCTTATTAACTATATTAGGGAAAACAATGGCCACGGTAGTTGGAGATCTCTCCCCAAGCTTGCAGGTTTAGTGATCCAAAATTTTCGCTAG ATGAGATTGGAAGAGGGAAGAGGGAAGAGGGAAGAGGGAGTTTTGGAAGACCCACAAGGGAACAGTGGTGAAGGCCTGGTCTTGTCATGGAGTGTCTCTGCCTCTGGTAGTGAAAGCTGTGAGATGGGGAGGACACCTTGTTGTGATAAGAAGGGGCTAAAGAAAGGGCCGTGGACATCGGAAGAAGATGAACTCCTTATTAACTATATTAGGGAAAACAATGGCCACGGTAGTTGGAGATCTCTCCCCAAGCTTGCAGGTTTAGTGATCCAAAATTTTCGCTAG ATGAGATTGGAAGAGGGAAGAGGGAAGAGGGAAGAGGGAGTTTTGGAAGACCCACAAGGGAACAGTGGTGAAGGCCTGGTCTTGTCATGGAGTGTCTCTGCCTCTGGTAGTGAAAGCTGTGAGATGGGGAGGACACCTTGTTGTGATAAGAAGGGGCTAAAGAAAGGGCCGTGGACATCGGAAGAAGATGAACTCCTTATTAACTATATTAGGGAAAACAATGGCCACGGTAGTTGGAGATCTCTCCCCAAGCTTGCAGGTTTAGTGATCCAAAATTTTCGCTAG MRLEEGRGKREEGVLEDPQGNSGEGLVLSWSVSASGSESCEMGRTPCCDKKGLKKGPWTSEEDELLINYIRENNGHGSWRSLPKLAGLVIQNFR*
BLAST of Csa3G122510 vs. Swiss-Prot
Match: MYBP_MAIZE (Myb-related protein P OS=Zea mays GN=P PE=2 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.2e-13 Identity = 35/48 (72.92%), Postives = 39/48 (81.25%), Query Frame = 1
BLAST of Csa3G122510 vs. Swiss-Prot
Match: MYB4_ORYSJ (Myb-related protein Myb4 OS=Oryza sativa subsp. japonica GN=MYB4 PE=2 SV=2) HSP 1 Score: 74.7 bits (182), Expect = 6.0e-13 Identity = 31/48 (64.58%), Postives = 39/48 (81.25%), Query Frame = 1
BLAST of Csa3G122510 vs. Swiss-Prot
Match: MYB12_ARATH (Transcription factor MYB12 OS=Arabidopsis thaliana GN=MYB12 PE=2 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 7.9e-13 Identity = 32/47 (68.09%), Postives = 38/47 (80.85%), Query Frame = 1
BLAST of Csa3G122510 vs. Swiss-Prot
Match: MYB39_ARATH (Transcription factor MYB39 OS=Arabidopsis thaliana GN=MYB39 PE=2 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 2.3e-12 Identity = 34/48 (70.83%), Postives = 38/48 (79.17%), Query Frame = 1
BLAST of Csa3G122510 vs. Swiss-Prot
Match: MYB2_PHYPA (Myb-related protein Pp2 OS=Physcomitrella patens subsp. patens GN=PP2 PE=2 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 6.7e-12 Identity = 30/48 (62.50%), Postives = 38/48 (79.17%), Query Frame = 1
BLAST of Csa3G122510 vs. TrEMBL
Match: A0A0A0L7H5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G122510 PE=4 SV=1) HSP 1 Score: 199.5 bits (506), Expect = 1.8e-48 Identity = 94/94 (100.00%), Postives = 94/94 (100.00%), Query Frame = 1
BLAST of Csa3G122510 vs. TrEMBL
Match: W9S0V5_9ROSA (Protein ODORANT1 OS=Morus notabilis GN=L484_017314 PE=4 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 1.1e-18 Identity = 41/48 (85.42%), Postives = 47/48 (97.92%), Query Frame = 1
BLAST of Csa3G122510 vs. TrEMBL
Match: A0A151S3U7_CAJCA (Myb-related protein Pp2 OS=Cajanus cajan GN=KK1_028866 PE=4 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 2.8e-17 Identity = 39/48 (81.25%), Postives = 46/48 (95.83%), Query Frame = 1
BLAST of Csa3G122510 vs. TrEMBL
Match: G7L3J2_MEDTR (Myb transcription factor MIXTA-like protein OS=Medicago truncatula GN=MTR_7g076740 PE=4 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 2.8e-17 Identity = 39/48 (81.25%), Postives = 45/48 (93.75%), Query Frame = 1
BLAST of Csa3G122510 vs. TrEMBL
Match: A0A0L9U309_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan03g053700 PE=4 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 8.2e-17 Identity = 38/48 (79.17%), Postives = 46/48 (95.83%), Query Frame = 1
BLAST of Csa3G122510 vs. TAIR10
Match: AT3G61250.1 (AT3G61250.1 myb domain protein 17) HSP 1 Score: 84.7 bits (208), Expect = 3.3e-17 Identity = 37/48 (77.08%), Postives = 42/48 (87.50%), Query Frame = 1
BLAST of Csa3G122510 vs. TAIR10
Match: AT3G02940.1 (AT3G02940.1 myb domain protein 107) HSP 1 Score: 80.5 bits (197), Expect = 6.2e-16 Identity = 35/47 (74.47%), Postives = 40/47 (85.11%), Query Frame = 1
BLAST of Csa3G122510 vs. TAIR10
Match: AT5G15310.1 (AT5G15310.1 myb domain protein 16) HSP 1 Score: 78.6 bits (192), Expect = 2.4e-15 Identity = 35/47 (74.47%), Postives = 38/47 (80.85%), Query Frame = 1
BLAST of Csa3G122510 vs. TAIR10
Match: AT1G34670.1 (AT1G34670.1 myb domain protein 93) HSP 1 Score: 78.2 bits (191), Expect = 3.1e-15 Identity = 34/47 (72.34%), Postives = 39/47 (82.98%), Query Frame = 1
BLAST of Csa3G122510 vs. TAIR10
Match: AT5G16770.1 (AT5G16770.1 myb domain protein 9) HSP 1 Score: 77.4 bits (189), Expect = 5.3e-15 Identity = 33/47 (70.21%), Postives = 39/47 (82.98%), Query Frame = 1
BLAST of Csa3G122510 vs. NCBI nr
Match: gi|700201394|gb|KGN56527.1| (hypothetical protein Csa_3G122510 [Cucumis sativus]) HSP 1 Score: 199.5 bits (506), Expect = 2.6e-48 Identity = 94/94 (100.00%), Postives = 94/94 (100.00%), Query Frame = 1
BLAST of Csa3G122510 vs. NCBI nr
Match: gi|449432165|ref|XP_004133870.1| (PREDICTED: transcription repressor MYB6 [Cucumis sativus]) HSP 1 Score: 107.1 bits (266), Expect = 1.8e-20 Identity = 47/48 (97.92%), Postives = 48/48 (100.00%), Query Frame = 1
BLAST of Csa3G122510 vs. NCBI nr
Match: gi|1009142262|ref|XP_015888628.1| (PREDICTED: transcription factor MYB34 [Ziziphus jujuba]) HSP 1 Score: 102.8 bits (255), Expect = 3.3e-19 Identity = 43/48 (89.58%), Postives = 48/48 (100.00%), Query Frame = 1
BLAST of Csa3G122510 vs. NCBI nr
Match: gi|703135720|ref|XP_010105966.1| (Protein ODORANT1 [Morus notabilis]) HSP 1 Score: 100.5 bits (249), Expect = 1.6e-18 Identity = 41/48 (85.42%), Postives = 47/48 (97.92%), Query Frame = 1
BLAST of Csa3G122510 vs. NCBI nr
Match: gi|502157248|ref|XP_004510807.1| (PREDICTED: transcription repressor MYB5-like [Cicer arietinum]) HSP 1 Score: 96.3 bits (238), Expect = 3.1e-17 Identity = 40/48 (83.33%), Postives = 46/48 (95.83%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|