Csa2G409490 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCAGATTATCAATTATATTACAGAGAACATGTAGTTGGAAGCAGTTCTTTTGGTGTAGTTTTTCAAGTAAGTATTAGGGGTATGTGATGCGCTAGCTTATTCTATGTTTCTTCCATGTGACTTCGTAGTTGAAAATTTGAGTTAACCTAGTCACTTTTGATAGGCAAAATGTAGAGAAACTGGAGAAATTGTTACAATCAAGAAGGTTCTTCAAGATAAGCGATATAAGAATAGGGAACGACAGATTGTGCAAATGTTGGATCACCCAAATATTGTTTCTCTAAAGCTTTGTTTCTTTTCAACAACATACAAAGAGAAGGTCTATTTGAACCTAGTGCTTCCAACAAGTCCAACACATTAG ATGCCAGATTATCAATTATATTACAGAGAACATGTAGTTGGAAGCAGTTCTTTTGGTGTAGTTTTTCAAGCAAAATGTAGAGAAACTGGAGAAATTGTTACAATCAAGAAGGTTCTTCAAGATAAGCGATATAAGAATAGGGAACGACAGATTGTGCAAATGTTGGATCACCCAAATATTGTTTCTCTAAAGCTTTGTTTCTTTTCAACAACATACAAAGAGAAGGTCTATTTGAACCTAGTGCTTCCAACAAGTCCAACACATTAG ATGCCAGATTATCAATTATATTACAGAGAACATGTAGTTGGAAGCAGTTCTTTTGGTGTAGTTTTTCAAGCAAAATGTAGAGAAACTGGAGAAATTGTTACAATCAAGAAGGTTCTTCAAGATAAGCGATATAAGAATAGGGAACGACAGATTGTGCAAATGTTGGATCACCCAAATATTGTTTCTCTAAAGCTTTGTTTCTTTTCAACAACATACAAAGAGAAGGTCTATTTGAACCTAGTGCTTCCAACAAGTCCAACACATTAG MPDYQLYYREHVVGSSSFGVVFQAKCRETGEIVTIKKVLQDKRYKNRERQIVQMLDHPNIVSLKLCFFSTTYKEKVYLNLVLPTSPTH*
BLAST of Csa2G409490 vs. Swiss-Prot
Match: KSG10_ARATH (Shaggy-related protein kinase kappa OS=Arabidopsis thaliana GN=ASK10 PE=2 SV=2) HSP 1 Score: 121.3 bits (303), Expect = 5.3e-27 Identity = 60/80 (75.00%), Postives = 64/80 (80.00%), Query Frame = 1
BLAST of Csa2G409490 vs. Swiss-Prot
Match: KSG4_ARATH (Shaggy-related protein kinase delta OS=Arabidopsis thaliana GN=ASK4 PE=2 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 5.3e-27 Identity = 59/80 (73.75%), Postives = 64/80 (80.00%), Query Frame = 1
BLAST of Csa2G409490 vs. Swiss-Prot
Match: MSK3_MEDSA (Glycogen synthase kinase-3 homolog MsK-3 OS=Medicago sativa GN=MSK-3 PE=2 SV=2) HSP 1 Score: 118.6 bits (296), Expect = 3.4e-26 Identity = 58/80 (72.50%), Postives = 63/80 (78.75%), Query Frame = 1
BLAST of Csa2G409490 vs. Swiss-Prot
Match: MSK1_MEDSA (Glycogen synthase kinase-3 homolog MsK-1 OS=Medicago sativa GN=MSK-1 PE=2 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 3.4e-26 Identity = 58/80 (72.50%), Postives = 63/80 (78.75%), Query Frame = 1
BLAST of Csa2G409490 vs. Swiss-Prot
Match: KSG5_ARATH (Shaggy-related protein kinase epsilon OS=Arabidopsis thaliana GN=ASK5 PE=2 SV=1) HSP 1 Score: 118.2 bits (295), Expect = 4.5e-26 Identity = 56/80 (70.00%), Postives = 63/80 (78.75%), Query Frame = 1
BLAST of Csa2G409490 vs. TrEMBL
Match: A0A0A0LMQ3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G409490 PE=4 SV=1) HSP 1 Score: 182.2 bits (461), Expect = 2.8e-43 Identity = 88/88 (100.00%), Postives = 88/88 (100.00%), Query Frame = 1
BLAST of Csa2G409490 vs. TrEMBL
Match: A0A0A0L197_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G308520 PE=3 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 8.8e-29 Identity = 67/80 (83.75%), Postives = 70/80 (87.50%), Query Frame = 1
BLAST of Csa2G409490 vs. TrEMBL
Match: A0A067L1Z5_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_00254 PE=3 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 1.9e-28 Identity = 66/80 (82.50%), Postives = 70/80 (87.50%), Query Frame = 1
BLAST of Csa2G409490 vs. TrEMBL
Match: M5XQD5_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa006218mg PE=3 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 1.9e-28 Identity = 66/80 (82.50%), Postives = 70/80 (87.50%), Query Frame = 1
BLAST of Csa2G409490 vs. TrEMBL
Match: A0A0J8C2F6_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_6g145100 PE=3 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 2.5e-28 Identity = 65/80 (81.25%), Postives = 70/80 (87.50%), Query Frame = 1
BLAST of Csa2G409490 vs. TAIR10
Match: AT1G57870.3 (AT1G57870.3 shaggy-like kinase 42) HSP 1 Score: 121.3 bits (303), Expect = 3.0e-28 Identity = 59/80 (73.75%), Postives = 64/80 (80.00%), Query Frame = 1
BLAST of Csa2G409490 vs. TAIR10
Match: AT1G09840.1 (AT1G09840.1 shaggy-like protein kinase 41) HSP 1 Score: 121.3 bits (303), Expect = 3.0e-28 Identity = 60/80 (75.00%), Postives = 64/80 (80.00%), Query Frame = 1
BLAST of Csa2G409490 vs. TAIR10
Match: AT5G14640.1 (AT5G14640.1 shaggy-like kinase 13) HSP 1 Score: 118.2 bits (295), Expect = 2.5e-27 Identity = 56/80 (70.00%), Postives = 63/80 (78.75%), Query Frame = 1
BLAST of Csa2G409490 vs. TAIR10
Match: AT3G05840.2 (AT3G05840.2 Protein kinase superfamily protein) HSP 1 Score: 117.5 bits (293), Expect = 4.3e-27 Identity = 57/80 (71.25%), Postives = 63/80 (78.75%), Query Frame = 1
BLAST of Csa2G409490 vs. TAIR10
Match: AT5G26751.1 (AT5G26751.1 shaggy-related kinase 11) HSP 1 Score: 117.5 bits (293), Expect = 4.3e-27 Identity = 57/80 (71.25%), Postives = 63/80 (78.75%), Query Frame = 1
BLAST of Csa2G409490 vs. NCBI nr
Match: gi|700208086|gb|KGN63205.1| (hypothetical protein Csa_2G409490 [Cucumis sativus]) HSP 1 Score: 182.2 bits (461), Expect = 4.0e-43 Identity = 88/88 (100.00%), Postives = 88/88 (100.00%), Query Frame = 1
BLAST of Csa2G409490 vs. NCBI nr
Match: gi|449460309|ref|XP_004147888.1| (PREDICTED: shaggy-related protein kinase kappa [Cucumis sativus]) HSP 1 Score: 134.0 bits (336), Expect = 1.3e-28 Identity = 67/80 (83.75%), Postives = 70/80 (87.50%), Query Frame = 1
BLAST of Csa2G409490 vs. NCBI nr
Match: gi|802563049|ref|XP_012066688.1| (PREDICTED: shaggy-related protein kinase kappa [Jatropha curcas]) HSP 1 Score: 132.9 bits (333), Expect = 2.8e-28 Identity = 66/80 (82.50%), Postives = 70/80 (87.50%), Query Frame = 1
BLAST of Csa2G409490 vs. NCBI nr
Match: gi|658061195|ref|XP_008366455.1| (PREDICTED: shaggy-related protein kinase kappa-like [Malus domestica]) HSP 1 Score: 132.9 bits (333), Expect = 2.8e-28 Identity = 66/80 (82.50%), Postives = 70/80 (87.50%), Query Frame = 1
BLAST of Csa2G409490 vs. NCBI nr
Match: gi|694325701|ref|XP_009353785.1| (PREDICTED: shaggy-related protein kinase kappa-like [Pyrus x bretschneideri]) HSP 1 Score: 132.9 bits (333), Expect = 2.8e-28 Identity = 66/80 (82.50%), Postives = 70/80 (87.50%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |