Csa2G393180 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCAAAGCAAATCCATGAGATCAAAGATTTTCTTCTCACTGCAAGAAGAAAGGATGCCCGCTCGGTCAAAATCAAGAGGAGGAAAGATGTAGTGAAGTTTAAGGTTCGCTACTCAAGTACCTTTACACGCTCTGTGCCTTGACTCGGAGAAGGCTGAAAAATTGAAGCAGTCTCTTCCCCCAGGTTTGAGTGTGCAAGATCTTTGA ATGCCAAAGCAAATCCATGAGATCAAAGATTTTCTTCTCACTGCAAGAAGAAAGGATGCCCGCTCGGTCAAAATCAAGAGGAGGAAAGATGTAGTGAAGTTTAAGAAGGCTGAAAAATTGAAGCAGTCTCTTCCCCCAGGTTTGAGTGTGCAAGATCTTTGA ATGCCAAAGCAAATCCATGAGATCAAAGATTTTCTTCTCACTGCAAGAAGAAAGGATGCCCGCTCGGTCAAAATCAAGAGGAGGAAAGATGTAGTGAAGTTTAAGAAGGCTGAAAAATTGAAGCAGTCTCTTCCCCCAGGTTTGAGTGTGCAAGATCTTTGA MPKQIHEIKDFLLTARRKDARSVKIKRRKDVVKFKKAEKLKQSLPPGLSVQDL*
BLAST of Csa2G393180 vs. Swiss-Prot
Match: RL38_ARATH (60S ribosomal protein L38 OS=Arabidopsis thaliana GN=RPL38A PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 3.5e-18 Identity = 50/69 (72.46%), Postives = 50/69 (72.46%), Query Frame = 1
BLAST of Csa2G393180 vs. Swiss-Prot
Match: RL38_SOLLC (60S ribosomal protein L38 OS=Solanum lycopersicum GN=RPL38 PE=3 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 3.3e-16 Identity = 46/69 (66.67%), Postives = 50/69 (72.46%), Query Frame = 1
BLAST of Csa2G393180 vs. Swiss-Prot
Match: RL38_BRABE (60S ribosomal protein L38 OS=Branchiostoma belcheri GN=RPL38 PE=3 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 1.3e-15 Identity = 45/69 (65.22%), Postives = 49/69 (71.01%), Query Frame = 1
BLAST of Csa2G393180 vs. Swiss-Prot
Match: RL38_MOUSE (60S ribosomal protein L38 OS=Mus musculus GN=Rpl38 PE=1 SV=3) HSP 1 Score: 79.7 bits (195), Expect = 1.1e-14 Identity = 44/69 (63.77%), Postives = 48/69 (69.57%), Query Frame = 1
BLAST of Csa2G393180 vs. Swiss-Prot
Match: RL38_HUMAN (60S ribosomal protein L38 OS=Homo sapiens GN=RPL38 PE=1 SV=2) HSP 1 Score: 78.2 bits (191), Expect = 3.1e-14 Identity = 43/69 (62.32%), Postives = 48/69 (69.57%), Query Frame = 1
BLAST of Csa2G393180 vs. TrEMBL
Match: A0A0A0LSS2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G393180 PE=3 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 2.0e-20 Identity = 53/53 (100.00%), Postives = 53/53 (100.00%), Query Frame = 1
BLAST of Csa2G393180 vs. TrEMBL
Match: A0A103XJ90_CYNCS (Ribosomal protein L38e OS=Cynara cardunculus var. scolymus GN=Ccrd_006297 PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 3.0e-16 Identity = 51/69 (73.91%), Postives = 52/69 (75.36%), Query Frame = 1
BLAST of Csa2G393180 vs. TrEMBL
Match: A0A0A0KBT2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G081500 PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 3.0e-16 Identity = 51/69 (73.91%), Postives = 52/69 (75.36%), Query Frame = 1
BLAST of Csa2G393180 vs. TrEMBL
Match: A0A068U8M1_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00018662001 PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 3.0e-16 Identity = 51/69 (73.91%), Postives = 52/69 (75.36%), Query Frame = 1
BLAST of Csa2G393180 vs. TrEMBL
Match: I3SRE3_LOTJA (Uncharacterized protein OS=Lotus japonicus PE=2 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 3.0e-16 Identity = 51/69 (73.91%), Postives = 52/69 (75.36%), Query Frame = 1
BLAST of Csa2G393180 vs. TAIR10
Match: AT2G43460.1 (AT2G43460.1 Ribosomal L38e protein family) HSP 1 Score: 91.3 bits (225), Expect = 2.0e-19 Identity = 50/69 (72.46%), Postives = 50/69 (72.46%), Query Frame = 1
BLAST of Csa2G393180 vs. TAIR10
Match: AT3G59540.1 (AT3G59540.1 Ribosomal L38e protein family) HSP 1 Score: 91.3 bits (225), Expect = 2.0e-19 Identity = 50/69 (72.46%), Postives = 50/69 (72.46%), Query Frame = 1
BLAST of Csa2G393180 vs. NCBI nr
Match: gi|700207932|gb|KGN63051.1| (hypothetical protein Csa_2G393180 [Cucumis sativus]) HSP 1 Score: 105.5 bits (262), Expect = 2.9e-20 Identity = 53/53 (100.00%), Postives = 53/53 (100.00%), Query Frame = 1
BLAST of Csa2G393180 vs. NCBI nr
Match: gi|976903921|gb|KVH91673.1| (Ribosomal protein L38e [Cynara cardunculus var. scolymus]) HSP 1 Score: 91.7 bits (226), Expect = 4.3e-16 Identity = 51/69 (73.91%), Postives = 52/69 (75.36%), Query Frame = 1
BLAST of Csa2G393180 vs. NCBI nr
Match: gi|629123314|gb|KCW87739.1| (hypothetical protein EUGRSUZ_A00108, partial [Eucalyptus grandis]) HSP 1 Score: 91.7 bits (226), Expect = 4.3e-16 Identity = 51/69 (73.91%), Postives = 52/69 (75.36%), Query Frame = 1
BLAST of Csa2G393180 vs. NCBI nr
Match: gi|902189617|gb|KNA11420.1| (hypothetical protein SOVF_135380 [Spinacia oleracea]) HSP 1 Score: 91.7 bits (226), Expect = 4.3e-16 Identity = 51/69 (73.91%), Postives = 52/69 (75.36%), Query Frame = 1
BLAST of Csa2G393180 vs. NCBI nr
Match: gi|297735234|emb|CBI17596.3| (unnamed protein product [Vitis vinifera]) HSP 1 Score: 91.7 bits (226), Expect = 4.3e-16 Identity = 51/69 (73.91%), Postives = 52/69 (75.36%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|