Csa2G258820 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATCCAACGAGTACTCTATTTTCTAAATCAAGTTCCATATCAAGCAAGACACCGCTCAAACTCAATCACTTTTCTCTTGTTTCGAGTAAATTTTCGATATGGGAATTCGTCTACAATCGATTCTTCTCAACGCCAAGCAGATTTTGAAAATGCAAGCTATGTCAGCCAGAAATCAATCTGATGTTCCCAAAGGCCATATTGCAGTTTACGTGGGAGAGATTCAAAGGAAGAGATTTGTCGTCCCTATATCATACTTGAAGAATCCTTCTTTTGTAGATCTGCTCAATAGATCAGAAGAAGAATTTGGATTTTGCCACCCAATGGGCGGCTTGACGATTCCATGCCGAGAGGATGCTTTCATAAATCTCACTGCCAGGCTGCACACGTCATGAAAGAGAACAAAAAAGAAAAGAAATGTTCTTGATCACAGTTTTGTCGCCTATAATTTTAGGAAGTAGTAGGATAATACTGTACAGTAACTTCGTTGTTTGAGCAATTGAAATTACATTCTTCTCATA ATGGGAATTCGTCTACAATCGATTCTTCTCAACGCCAAGCAGATTTTGAAAATGCAAGCTATGTCAGCCAGAAATCAATCTGATGTTCCCAAAGGCCATATTGCAGTTTACGTGGGAGAGATTCAAAGGAAGAGATTTGTCGTCCCTATATCATACTTGAAGAATCCTTCTTTTGTAGATCTGCTCAATAGATCAGAAGAAGAATTTGGATTTTGCCACCCAATGGGCGGCTTGACGATTCCATGCCGAGAGGATGCTTTCATAAATCTCACTGCCAGGCTGCACACGTCATGA ATGGGAATTCGTCTACAATCGATTCTTCTCAACGCCAAGCAGATTTTGAAAATGCAAGCTATGTCAGCCAGAAATCAATCTGATGTTCCCAAAGGCCATATTGCAGTTTACGTGGGAGAGATTCAAAGGAAGAGATTTGTCGTCCCTATATCATACTTGAAGAATCCTTCTTTTGTAGATCTGCTCAATAGATCAGAAGAAGAATTTGGATTTTGCCACCCAATGGGCGGCTTGACGATTCCATGCCGAGAGGATGCTTTCATAAATCTCACTGCCAGGCTGCACACGTCATGA MGIRLQSILLNAKQILKMQAMSARNQSDVPKGHIAVYVGEIQRKRFVVPISYLKNPSFVDLLNRSEEEFGFCHPMGGLTIPCREDAFINLTARLHTS*
BLAST of Csa2G258820 vs. Swiss-Prot
Match: SAU23_ARATH (Auxin-responsive protein SAUR23 OS=Arabidopsis thaliana GN=SAUR23 PE=2 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 7.8e-24 Identity = 56/87 (64.37%), Postives = 65/87 (74.71%), Query Frame = 1
BLAST of Csa2G258820 vs. Swiss-Prot
Match: SAU19_ARATH (Auxin-responsive protein SAUR19 OS=Arabidopsis thaliana GN=SAUR19 PE=2 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 2.3e-23 Identity = 54/86 (62.79%), Postives = 63/86 (73.26%), Query Frame = 1
BLAST of Csa2G258820 vs. Swiss-Prot
Match: SAU21_ARATH (Auxin-responsive protein SAUR21 OS=Arabidopsis thaliana GN=SAUR21 PE=2 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 2.3e-23 Identity = 55/86 (63.95%), Postives = 63/86 (73.26%), Query Frame = 1
BLAST of Csa2G258820 vs. Swiss-Prot
Match: SAU20_ARATH (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana GN=SAUR20 PE=2 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 3.0e-23 Identity = 55/85 (64.71%), Postives = 63/85 (74.12%), Query Frame = 1
BLAST of Csa2G258820 vs. Swiss-Prot
Match: SAU24_ARATH (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana GN=SAUR24 PE=2 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 5.1e-23 Identity = 55/86 (63.95%), Postives = 64/86 (74.42%), Query Frame = 1
BLAST of Csa2G258820 vs. TrEMBL
Match: A0A0A0LPJ1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258820 PE=4 SV=1) HSP 1 Score: 196.4 bits (498), Expect = 1.6e-47 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 1
BLAST of Csa2G258820 vs. TrEMBL
Match: A0A0A0LM74_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258830 PE=4 SV=1) HSP 1 Score: 191.8 bits (486), Expect = 3.9e-46 Identity = 95/97 (97.94%), Postives = 95/97 (97.94%), Query Frame = 1
BLAST of Csa2G258820 vs. TrEMBL
Match: A0A0A0LJ03_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258810 PE=4 SV=1) HSP 1 Score: 169.9 bits (429), Expect = 1.6e-39 Identity = 82/90 (91.11%), Postives = 86/90 (95.56%), Query Frame = 1
BLAST of Csa2G258820 vs. TrEMBL
Match: A0A0A0LPH3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258670 PE=4 SV=1) HSP 1 Score: 154.5 bits (389), Expect = 6.9e-35 Identity = 71/97 (73.20%), Postives = 88/97 (90.72%), Query Frame = 1
BLAST of Csa2G258820 vs. TrEMBL
Match: A0A0A0LPG7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258620 PE=4 SV=1) HSP 1 Score: 152.9 bits (385), Expect = 2.0e-34 Identity = 73/97 (75.26%), Postives = 87/97 (89.69%), Query Frame = 1
BLAST of Csa2G258820 vs. TAIR10
Match: AT4G38840.1 (AT4G38840.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 115.2 bits (287), Expect = 2.3e-26 Identity = 56/99 (56.57%), Postives = 72/99 (72.73%), Query Frame = 1
BLAST of Csa2G258820 vs. TAIR10
Match: AT2G21210.1 (AT2G21210.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 114.4 bits (285), Expect = 4.0e-26 Identity = 56/98 (57.14%), Postives = 74/98 (75.51%), Query Frame = 1
BLAST of Csa2G258820 vs. TAIR10
Match: AT4G34810.1 (AT4G34810.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 110.9 bits (276), Expect = 4.4e-25 Identity = 56/101 (55.45%), Postives = 74/101 (73.27%), Query Frame = 1
BLAST of Csa2G258820 vs. TAIR10
Match: AT5G18060.1 (AT5G18060.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 110.9 bits (276), Expect = 4.4e-25 Identity = 56/87 (64.37%), Postives = 65/87 (74.71%), Query Frame = 1
BLAST of Csa2G258820 vs. TAIR10
Match: AT5G18010.1 (AT5G18010.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 109.4 bits (272), Expect = 1.3e-24 Identity = 54/86 (62.79%), Postives = 63/86 (73.26%), Query Frame = 1
BLAST of Csa2G258820 vs. NCBI nr
Match: gi|700206767|gb|KGN61886.1| (hypothetical protein Csa_2G258820 [Cucumis sativus]) HSP 1 Score: 196.4 bits (498), Expect = 2.3e-47 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 1
BLAST of Csa2G258820 vs. NCBI nr
Match: gi|778669611|ref|XP_011649277.1| (PREDICTED: auxin-induced protein X15-like [Cucumis sativus]) HSP 1 Score: 191.8 bits (486), Expect = 5.6e-46 Identity = 95/97 (97.94%), Postives = 95/97 (97.94%), Query Frame = 1
BLAST of Csa2G258820 vs. NCBI nr
Match: gi|778669614|ref|XP_011649278.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 191.8 bits (486), Expect = 5.6e-46 Identity = 94/97 (96.91%), Postives = 96/97 (98.97%), Query Frame = 1
BLAST of Csa2G258820 vs. NCBI nr
Match: gi|659115604|ref|XP_008457639.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 187.2 bits (474), Expect = 1.4e-44 Identity = 92/97 (94.85%), Postives = 95/97 (97.94%), Query Frame = 1
BLAST of Csa2G258820 vs. NCBI nr
Match: gi|700206766|gb|KGN61885.1| (hypothetical protein Csa_2G258810 [Cucumis sativus]) HSP 1 Score: 169.9 bits (429), Expect = 2.3e-39 Identity = 82/90 (91.11%), Postives = 86/90 (95.56%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|