Csa2G258670 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAATTCGTATGCCTTCGCTTCTCCTTAATGCCAAGCAAATATTCAGAATGCAATCTGTTTCAACAAGATGTCATTCCAACATTCCCAAAGGTCACATTGCAGTTTACGTGGGCGAGATTGAACGGAAGCGATTTGTGGTGCCGGTATCATACTTGAACCATCCTACATTTCTAAGTTTGCTCAACAGAGCTGAAGAAGAGTTTGGATTCAACCATCCAAGTGGGGGTTTGACAATTCCCTGCAAAGAAGATGCCTTCATTGATCTCACTTCAAAATTGCATACCTCTTGAAAAGTAGAACAAACAAAAGCTACAATTTCCAACCAAAAGAGTGGAACAATTTTAC ATGGGAATTCGTATGCCTTCGCTTCTCCTTAATGCCAAGCAAATATTCAGAATGCAATCTGTTTCAACAAGATGTCATTCCAACATTCCCAAAGGTCACATTGCAGTTTACGTGGGCGAGATTGAACGGAAGCGATTTGTGGTGCCGGTATCATACTTGAACCATCCTACATTTCTAAGTTTGCTCAACAGAGCTGAAGAAGAGTTTGGATTCAACCATCCAAGTGGGGGTTTGACAATTCCCTGCAAAGAAGATGCCTTCATTGATCTCACTTCAAAATTGCATACCTCTTGA ATGGGAATTCGTATGCCTTCGCTTCTCCTTAATGCCAAGCAAATATTCAGAATGCAATCTGTTTCAACAAGATGTCATTCCAACATTCCCAAAGGTCACATTGCAGTTTACGTGGGCGAGATTGAACGGAAGCGATTTGTGGTGCCGGTATCATACTTGAACCATCCTACATTTCTAAGTTTGCTCAACAGAGCTGAAGAAGAGTTTGGATTCAACCATCCAAGTGGGGGTTTGACAATTCCCTGCAAAGAAGATGCCTTCATTGATCTCACTTCAAAATTGCATACCTCTTGA MGIRMPSLLLNAKQIFRMQSVSTRCHSNIPKGHIAVYVGEIERKRFVVPVSYLNHPTFLSLLNRAEEEFGFNHPSGGLTIPCKEDAFIDLTSKLHTS*
BLAST of Csa2G258670 vs. Swiss-Prot
Match: SAU24_ARATH (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana GN=SAUR24 PE=2 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 8.7e-23 Identity = 53/86 (61.63%), Postives = 66/86 (76.74%), Query Frame = 1
BLAST of Csa2G258670 vs. Swiss-Prot
Match: SAU20_ARATH (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana GN=SAUR20 PE=2 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 2.5e-22 Identity = 51/85 (60.00%), Postives = 65/85 (76.47%), Query Frame = 1
BLAST of Csa2G258670 vs. Swiss-Prot
Match: SAU23_ARATH (Auxin-responsive protein SAUR23 OS=Arabidopsis thaliana GN=SAUR23 PE=2 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 3.3e-22 Identity = 52/87 (59.77%), Postives = 66/87 (75.86%), Query Frame = 1
BLAST of Csa2G258670 vs. Swiss-Prot
Match: SAU22_ARATH (Auxin-responsive protein SAUR22 OS=Arabidopsis thaliana GN=SAUR22 PE=2 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 4.3e-22 Identity = 51/86 (59.30%), Postives = 66/86 (76.74%), Query Frame = 1
BLAST of Csa2G258670 vs. Swiss-Prot
Match: SAU19_ARATH (Auxin-responsive protein SAUR19 OS=Arabidopsis thaliana GN=SAUR19 PE=2 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.3e-21 Identity = 51/86 (59.30%), Postives = 65/86 (75.58%), Query Frame = 1
BLAST of Csa2G258670 vs. TrEMBL
Match: A0A0A0LPH3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258670 PE=4 SV=1) HSP 1 Score: 199.9 bits (507), Expect = 1.4e-48 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 1
BLAST of Csa2G258670 vs. TrEMBL
Match: A0A0A0LIZ4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258710 PE=4 SV=1) HSP 1 Score: 164.5 bits (415), Expect = 6.7e-38 Identity = 73/97 (75.26%), Postives = 89/97 (91.75%), Query Frame = 1
BLAST of Csa2G258670 vs. TrEMBL
Match: A0A0A0LM65_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258730 PE=4 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 4.3e-37 Identity = 72/97 (74.23%), Postives = 92/97 (94.85%), Query Frame = 1
BLAST of Csa2G258670 vs. TrEMBL
Match: A0A0A0LPG7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258620 PE=4 SV=1) HSP 1 Score: 159.8 bits (403), Expect = 1.6e-36 Identity = 73/97 (75.26%), Postives = 88/97 (90.72%), Query Frame = 1
BLAST of Csa2G258670 vs. TrEMBL
Match: A0A0A0LLF7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258750 PE=4 SV=1) HSP 1 Score: 159.1 bits (401), Expect = 2.8e-36 Identity = 72/97 (74.23%), Postives = 89/97 (91.75%), Query Frame = 1
BLAST of Csa2G258670 vs. TAIR10
Match: AT4G38840.1 (AT4G38840.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 114.4 bits (285), Expect = 4.0e-26 Identity = 56/99 (56.57%), Postives = 71/99 (71.72%), Query Frame = 1
BLAST of Csa2G258670 vs. TAIR10
Match: AT2G21210.1 (AT2G21210.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 113.2 bits (282), Expect = 8.9e-26 Identity = 57/98 (58.16%), Postives = 73/98 (74.49%), Query Frame = 1
BLAST of Csa2G258670 vs. TAIR10
Match: AT4G34810.1 (AT4G34810.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 110.9 bits (276), Expect = 4.4e-25 Identity = 53/99 (53.54%), Postives = 71/99 (71.72%), Query Frame = 1
BLAST of Csa2G258670 vs. TAIR10
Match: AT4G34790.1 (AT4G34790.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 109.8 bits (273), Expect = 9.8e-25 Identity = 58/102 (56.86%), Postives = 72/102 (70.59%), Query Frame = 1
BLAST of Csa2G258670 vs. TAIR10
Match: AT4G34800.1 (AT4G34800.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 108.2 bits (269), Expect = 2.9e-24 Identity = 55/92 (59.78%), Postives = 67/92 (72.83%), Query Frame = 1
BLAST of Csa2G258670 vs. NCBI nr
Match: gi|778669580|ref|XP_011649270.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 199.9 bits (507), Expect = 2.1e-48 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 1
BLAST of Csa2G258670 vs. NCBI nr
Match: gi|659115586|ref|XP_008457629.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 185.3 bits (469), Expect = 5.2e-44 Identity = 88/97 (90.72%), Postives = 93/97 (95.88%), Query Frame = 1
BLAST of Csa2G258670 vs. NCBI nr
Match: gi|449458550|ref|XP_004147010.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 164.5 bits (415), Expect = 9.6e-38 Identity = 73/97 (75.26%), Postives = 89/97 (91.75%), Query Frame = 1
BLAST of Csa2G258670 vs. NCBI nr
Match: gi|778669591|ref|XP_011649272.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 161.8 bits (408), Expect = 6.2e-37 Identity = 72/97 (74.23%), Postives = 92/97 (94.85%), Query Frame = 1
BLAST of Csa2G258670 vs. NCBI nr
Match: gi|659115590|ref|XP_008457631.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 161.8 bits (408), Expect = 6.2e-37 Identity = 71/97 (73.20%), Postives = 88/97 (90.72%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|