Csa2G258660 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.AAGAAAGTTTTTAGAGGGTGTTCGCCTCCTCTTTGTACGTGTTCTTCAGCCGATAACACAATTTAGCAATGGGAATTCGTTTGCCATCATCTTTGATTCATCATGCTAAGCAAATTCTTAAAATGAGAAACCAGTCAAATGTACCAAGAGGTCATATTGCTGTTTATGTGGGCGAGATCGATATTCAAAGAAAACGTTTCGTGGTTCCAATATCATTCCTAAACCATCCTTCATTTAAACAACTTCTCAGTCATGTTGAGGAAGAGTTTGGATTTCATCATCCCCATGGAGGTTTAACTATTCCTTGCAAAGAAGATGCCTTTGTAGATCTTACTTCTAGATTTCAACACTCCTAA ATGGGAATTCGTTTGCCATCATCTTTGATTCATCATGCTAAGCAAATTCTTAAAATGAGAAACCAGTCAAATGTACCAAGAGGTCATATTGCTGTTTATGTGGGCGAGATCGATATTCAAAGAAAACGTTTCGTGGTTCCAATATCATTCCTAAACCATCCTTCATTTAAACAACTTCTCAGTCATGTTGAGGAAGAGTTTGGATTTCATCATCCCCATGGAGGTTTAACTATTCCTTGCAAAGAAGATGCCTTTGTAGATCTTACTTCTAGATTTCAACACTCCTAA ATGGGAATTCGTTTGCCATCATCTTTGATTCATCATGCTAAGCAAATTCTTAAAATGAGAAACCAGTCAAATGTACCAAGAGGTCATATTGCTGTTTATGTGGGCGAGATCGATATTCAAAGAAAACGTTTCGTGGTTCCAATATCATTCCTAAACCATCCTTCATTTAAACAACTTCTCAGTCATGTTGAGGAAGAGTTTGGATTTCATCATCCCCATGGAGGTTTAACTATTCCTTGCAAAGAAGATGCCTTTGTAGATCTTACTTCTAGATTTCAACACTCCTAA MGIRLPSSLIHHAKQILKMRNQSNVPRGHIAVYVGEIDIQRKRFVVPISFLNHPSFKQLLSHVEEEFGFHHPHGGLTIPCKEDAFVDLTSRFQHS*
BLAST of Csa2G258660 vs. Swiss-Prot
Match: SAU15_ARATH (Auxin-responsive protein SAUR15 OS=Arabidopsis thaliana GN=SAUR15 PE=2 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 6.1e-21 Identity = 49/81 (60.49%), Postives = 60/81 (74.07%), Query Frame = 1
BLAST of Csa2G258660 vs. Swiss-Prot
Match: SAU21_ARATH (Auxin-responsive protein SAUR21 OS=Arabidopsis thaliana GN=SAUR21 PE=2 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 2.3e-20 Identity = 48/81 (59.26%), Postives = 59/81 (72.84%), Query Frame = 1
BLAST of Csa2G258660 vs. Swiss-Prot
Match: SAU20_ARATH (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana GN=SAUR20 PE=2 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 2.3e-20 Identity = 51/83 (61.45%), Postives = 60/83 (72.29%), Query Frame = 1
BLAST of Csa2G258660 vs. Swiss-Prot
Match: SAU24_ARATH (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana GN=SAUR24 PE=2 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 2.0e-19 Identity = 49/83 (59.04%), Postives = 59/83 (71.08%), Query Frame = 1
BLAST of Csa2G258660 vs. Swiss-Prot
Match: SAU22_ARATH (Auxin-responsive protein SAUR22 OS=Arabidopsis thaliana GN=SAUR22 PE=2 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 4.4e-19 Identity = 48/83 (57.83%), Postives = 59/83 (71.08%), Query Frame = 1
BLAST of Csa2G258660 vs. TrEMBL
Match: A0A0A0LIY9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258660 PE=4 SV=1) HSP 1 Score: 199.1 bits (505), Expect = 2.4e-48 Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = 1
BLAST of Csa2G258660 vs. TrEMBL
Match: A0A0A0LPI0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258720 PE=4 SV=1) HSP 1 Score: 149.1 bits (375), Expect = 2.8e-33 Identity = 77/98 (78.57%), Postives = 83/98 (84.69%), Query Frame = 1
BLAST of Csa2G258660 vs. TrEMBL
Match: A0A0A0LLF1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258700 PE=4 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 2.0e-31 Identity = 73/100 (73.00%), Postives = 83/100 (83.00%), Query Frame = 1
BLAST of Csa2G258660 vs. TrEMBL
Match: A0A0A0LJ99_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258740 PE=4 SV=1) HSP 1 Score: 137.1 bits (344), Expect = 1.1e-29 Identity = 70/98 (71.43%), Postives = 81/98 (82.65%), Query Frame = 1
BLAST of Csa2G258660 vs. TrEMBL
Match: A0A0A0LIZ9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258760 PE=4 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 1.5e-29 Identity = 70/100 (70.00%), Postives = 83/100 (83.00%), Query Frame = 1
BLAST of Csa2G258660 vs. TAIR10
Match: AT4G34810.1 (AT4G34810.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 112.1 bits (279), Expect = 1.9e-25 Identity = 57/93 (61.29%), Postives = 69/93 (74.19%), Query Frame = 1
BLAST of Csa2G258660 vs. TAIR10
Match: AT4G34800.1 (AT4G34800.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 108.2 bits (269), Expect = 2.8e-24 Identity = 55/92 (59.78%), Postives = 68/92 (73.91%), Query Frame = 1
BLAST of Csa2G258660 vs. TAIR10
Match: AT2G21210.1 (AT2G21210.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 105.1 bits (261), Expect = 2.4e-23 Identity = 52/99 (52.53%), Postives = 71/99 (71.72%), Query Frame = 1
BLAST of Csa2G258660 vs. TAIR10
Match: AT4G38850.1 (AT4G38850.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 101.3 bits (251), Expect = 3.4e-22 Identity = 49/81 (60.49%), Postives = 60/81 (74.07%), Query Frame = 1
BLAST of Csa2G258660 vs. TAIR10
Match: AT4G38840.1 (AT4G38840.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 99.8 bits (247), Expect = 1.0e-21 Identity = 52/101 (51.49%), Postives = 68/101 (67.33%), Query Frame = 1
BLAST of Csa2G258660 vs. NCBI nr
Match: gi|778669577|ref|XP_011649269.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 199.1 bits (505), Expect = 3.4e-48 Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = 1
BLAST of Csa2G258660 vs. NCBI nr
Match: gi|659115584|ref|XP_008457628.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 195.3 bits (495), Expect = 5.0e-47 Identity = 93/95 (97.89%), Postives = 94/95 (98.95%), Query Frame = 1
BLAST of Csa2G258660 vs. NCBI nr
Match: gi|700206757|gb|KGN61876.1| (hypothetical protein Csa_2G258720 [Cucumis sativus]) HSP 1 Score: 149.1 bits (375), Expect = 4.1e-33 Identity = 77/98 (78.57%), Postives = 83/98 (84.69%), Query Frame = 1
BLAST of Csa2G258660 vs. NCBI nr
Match: gi|659115592|ref|XP_008457632.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 144.8 bits (364), Expect = 7.7e-32 Identity = 75/98 (76.53%), Postives = 83/98 (84.69%), Query Frame = 1
BLAST of Csa2G258660 vs. NCBI nr
Match: gi|778674175|ref|XP_011650154.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 142.9 bits (359), Expect = 2.9e-31 Identity = 73/100 (73.00%), Postives = 83/100 (83.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|