Csa2G138730 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTAAGGGCTAGTAAGATTCTCACCCTAATGTTTTATTATAAATGTAAAAATGTTGGGGTGATATATATACTATTAGGGATGTTCAATATCAGTGGTTGGAGAAGCACTTCTTCCATACGGGTCTACAAGCTTCATAACAGCACAAGGAAGAACAAATCCAAATGATGCAAATGGTTTTGTATTCAAAGAATGCAATGTGTTTGGGAGTGGGTCAGCATACTTAGGAAGGCCATGGAGGGCTTATTCAAGAGTTATCTTTCACAACTCTAACTTCTCCAACATCATAAACCCTAATGGTTGGGATCCTTGGCAGTTTGTTGGTTATGAGTAA ATGGGATGTTCAATATCAGTGGTTGGAGAAGCACTTCTTCCATACGGGTCTACAAGCTTCATAACAGCACAAGGAAGAACAAATCCAAATGATGCAAATGGTTTTGTATTCAAAGAATGCAATGTGTTTGGGAGTGGGTCAGCATACTTAGGAAGGCCATGGAGGGCTTATTCAAGAGTTATCTTTCACAACTCTAACTTCTCCAACATCATAAACCCTAATGGTTGGGATCCTTGGCAGTTTGTTGGTTATGAGTAA ATGGGATGTTCAATATCAGTGGTTGGAGAAGCACTTCTTCCATACGGGTCTACAAGCTTCATAACAGCACAAGGAAGAACAAATCCAAATGATGCAAATGGTTTTGTATTCAAAGAATGCAATGTGTTTGGGAGTGGGTCAGCATACTTAGGAAGGCCATGGAGGGCTTATTCAAGAGTTATCTTTCACAACTCTAACTTCTCCAACATCATAAACCCTAATGGTTGGGATCCTTGGCAGTTTGTTGGTTATGAGTAA MGCSISVVGEALLPYGSTSFITAQGRTNPNDANGFVFKECNVFGSGSAYLGRPWRAYSRVIFHNSNFSNIINPNGWDPWQFVGYE*
BLAST of Csa2G138730 vs. Swiss-Prot
Match: PME29_ARATH (Probable pectinesterase 29 OS=Arabidopsis thaliana GN=PME29 PE=2 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 3.7e-25 Identity = 51/83 (61.45%), Postives = 61/83 (73.49%), Query Frame = 1
BLAST of Csa2G138730 vs. Swiss-Prot
Match: PME55_ARATH (Probable pectinesterase 55 OS=Arabidopsis thaliana GN=PME55 PE=2 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 5.8e-23 Identity = 51/83 (61.45%), Postives = 58/83 (69.88%), Query Frame = 1
BLAST of Csa2G138730 vs. Swiss-Prot
Match: PME10_ARATH (Putative pectinesterase 10 OS=Arabidopsis thaliana GN=PME10 PE=2 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 2.1e-17 Identity = 43/84 (51.19%), Postives = 51/84 (60.71%), Query Frame = 1
BLAST of Csa2G138730 vs. Swiss-Prot
Match: PME52_ARATH (Putative pectinesterase 52 OS=Arabidopsis thaliana GN=PME52 PE=2 SV=2) HSP 1 Score: 78.6 bits (192), Expect = 3.8e-14 Identity = 37/83 (44.58%), Postives = 51/83 (61.45%), Query Frame = 1
BLAST of Csa2G138730 vs. Swiss-Prot
Match: PME11_ARATH (Putative pectinesterase 11 OS=Arabidopsis thaliana GN=PME11 PE=3 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.1e-13 Identity = 33/59 (55.93%), Postives = 40/59 (67.80%), Query Frame = 1
BLAST of Csa2G138730 vs. TrEMBL
Match: A0A0A0LKA2_CUCSA (Pectinesterase OS=Cucumis sativus GN=Csa_2G138730 PE=4 SV=1) HSP 1 Score: 186.4 bits (472), Expect = 1.4e-44 Identity = 85/85 (100.00%), Postives = 85/85 (100.00%), Query Frame = 1
BLAST of Csa2G138730 vs. TrEMBL
Match: W9SM62_9ROSA (Pectinesterase OS=Morus notabilis GN=L484_021593 PE=4 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 2.7e-27 Identity = 59/83 (71.08%), Postives = 68/83 (81.93%), Query Frame = 1
BLAST of Csa2G138730 vs. TrEMBL
Match: A0A059CS97_EUCGR (Pectinesterase (Fragment) OS=Eucalyptus grandis GN=EUGRSUZ_C02449 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 1.0e-26 Identity = 58/83 (69.88%), Postives = 69/83 (83.13%), Query Frame = 1
BLAST of Csa2G138730 vs. TrEMBL
Match: B9RWI7_RICCO (Pectinesterase OS=Ricinus communis GN=RCOM_1019830 PE=4 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 3.9e-26 Identity = 55/84 (65.48%), Postives = 66/84 (78.57%), Query Frame = 1
BLAST of Csa2G138730 vs. TrEMBL
Match: A0A0D2S0P8_GOSRA (Pectinesterase OS=Gossypium raimondii GN=B456_006G222300 PE=4 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 6.7e-26 Identity = 56/84 (66.67%), Postives = 65/84 (77.38%), Query Frame = 1
BLAST of Csa2G138730 vs. TAIR10
Match: AT3G24130.1 (AT3G24130.1 Pectin lyase-like superfamily protein) HSP 1 Score: 115.2 bits (287), Expect = 2.1e-26 Identity = 51/83 (61.45%), Postives = 61/83 (73.49%), Query Frame = 1
BLAST of Csa2G138730 vs. TAIR10
Match: AT5G18990.1 (AT5G18990.1 Pectin lyase-like superfamily protein) HSP 1 Score: 107.8 bits (268), Expect = 3.3e-24 Identity = 51/83 (61.45%), Postives = 58/83 (69.88%), Query Frame = 1
BLAST of Csa2G138730 vs. TAIR10
Match: AT2G19150.1 (AT2G19150.1 Pectin lyase-like superfamily protein) HSP 1 Score: 89.4 bits (220), Expect = 1.2e-18 Identity = 43/84 (51.19%), Postives = 51/84 (60.71%), Query Frame = 1
BLAST of Csa2G138730 vs. TAIR10
Match: AT5G26810.1 (AT5G26810.1 Pectin lyase-like superfamily protein) HSP 1 Score: 78.6 bits (192), Expect = 2.1e-15 Identity = 37/83 (44.58%), Postives = 51/83 (61.45%), Query Frame = 1
BLAST of Csa2G138730 vs. TAIR10
Match: AT2G21610.1 (AT2G21610.1 pectinesterase 11) HSP 1 Score: 77.0 bits (188), Expect = 6.2e-15 Identity = 33/59 (55.93%), Postives = 40/59 (67.80%), Query Frame = 1
BLAST of Csa2G138730 vs. NCBI nr
Match: gi|700206350|gb|KGN61469.1| (hypothetical protein Csa_2G138730 [Cucumis sativus]) HSP 1 Score: 186.4 bits (472), Expect = 2.1e-44 Identity = 85/85 (100.00%), Postives = 85/85 (100.00%), Query Frame = 1
BLAST of Csa2G138730 vs. NCBI nr
Match: gi|778674132|ref|XP_011650140.1| (PREDICTED: probable pectinesterase 29 [Cucumis sativus]) HSP 1 Score: 184.5 bits (467), Expect = 7.8e-44 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 1
BLAST of Csa2G138730 vs. NCBI nr
Match: gi|659114888|ref|XP_008457276.1| (PREDICTED: probable pectinesterase 29 [Cucumis melo]) HSP 1 Score: 177.6 bits (449), Expect = 9.6e-42 Identity = 81/84 (96.43%), Postives = 82/84 (97.62%), Query Frame = 1
BLAST of Csa2G138730 vs. NCBI nr
Match: gi|703142522|ref|XP_010107773.1| (putative pectinesterase 29 [Morus notabilis]) HSP 1 Score: 129.0 bits (323), Expect = 3.9e-27 Identity = 59/83 (71.08%), Postives = 68/83 (81.93%), Query Frame = 1
BLAST of Csa2G138730 vs. NCBI nr
Match: gi|629116404|gb|KCW81079.1| (hypothetical protein EUGRSUZ_C02449, partial [Eucalyptus grandis]) HSP 1 Score: 127.1 bits (318), Expect = 1.5e-26 Identity = 58/83 (69.88%), Postives = 69/83 (83.13%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|