Csa2G076020 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTTTTCTGCTGCAGATTTCTGGAATAAGATTTATGTGGGAAAATATCATTCAATCAATACGGAAAGTGAAGTCTGGGGATAAAGGACTTGGATGCATTCTTGCTCATACAATGGGCCTTGGTAAAACTTTTCAGGTATTTGTTTCTTTGAGCTGTTACAGGCCCTTGTTTATTTATATGAAAGGTGGTTCTTTGATTTCCCCCCTCTATAAAGAAGATAAATAA ATGGTTTTTCTGCTGCAGATTTCTGGAATAAGATTTATGTGGGAAAATATCATTCAATCAATACGGAAAGTGAAGTCTGGGGATAAAGGACTTGGATGCATTCTTGCTCATACAATGGGCCTTGGTAAAACTTTTCAGGTATTTGTTTCTTTGAGCTGTTACAGGCCCTTGTTTATTTATATGAAAGGTGGTTCTTTGATTTCCCCCCTCTATAAAGAAGATAAATAA ATGGTTTTTCTGCTGCAGATTTCTGGAATAAGATTTATGTGGGAAAATATCATTCAATCAATACGGAAAGTGAAGTCTGGGGATAAAGGACTTGGATGCATTCTTGCTCATACAATGGGCCTTGGTAAAACTTTTCAGGTATTTGTTTCTTTGAGCTGTTACAGGCCCTTGTTTATTTATATGAAAGGTGGTTCTTTGATTTCCCCCCTCTATAAAGAAGATAAATAA MVFLLQISGIRFMWENIIQSIRKVKSGDKGLGCILAHTMGLGKTFQVFVSLSCYRPLFIYMKGGSLISPLYKEDK*
BLAST of Csa2G076020 vs. Swiss-Prot
Match: CHR20_ARATH (Protein CHROMATIN REMODELING 20 OS=Arabidopsis thaliana GN=ATRX PE=2 SV=2) HSP 1 Score: 85.9 bits (211), Expect = 2.1e-16 Identity = 42/66 (63.64%), Postives = 51/66 (77.27%), Query Frame = 1
BLAST of Csa2G076020 vs. Swiss-Prot
Match: ARIP4_XENTR (Helicase ARIP4 OS=Xenopus tropicalis GN=rad54l2 PE=2 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.0e-07 Identity = 25/42 (59.52%), Postives = 32/42 (76.19%), Query Frame = 1
BLAST of Csa2G076020 vs. Swiss-Prot
Match: ARIP4_HUMAN (Helicase ARIP4 OS=Homo sapiens GN=RAD54L2 PE=1 SV=4) HSP 1 Score: 55.5 bits (132), Expect = 3.0e-07 Identity = 24/42 (57.14%), Postives = 32/42 (76.19%), Query Frame = 1
BLAST of Csa2G076020 vs. Swiss-Prot
Match: ARIP4_MOUSE (Helicase ARIP4 OS=Mus musculus GN=Rad54l2 PE=1 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 3.0e-07 Identity = 24/42 (57.14%), Postives = 32/42 (76.19%), Query Frame = 1
BLAST of Csa2G076020 vs. Swiss-Prot
Match: ATRX_HUMAN (Transcriptional regulator ATRX OS=Homo sapiens GN=ATRX PE=1 SV=5) HSP 1 Score: 52.0 bits (123), Expect = 3.4e-06 Identity = 23/42 (54.76%), Postives = 28/42 (66.67%), Query Frame = 1
BLAST of Csa2G076020 vs. TrEMBL
Match: A0A0A0LH69_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G076020 PE=4 SV=1) HSP 1 Score: 154.5 bits (389), Expect = 5.3e-35 Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = 1
BLAST of Csa2G076020 vs. TrEMBL
Match: A0A0L9THU5_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan845s001500 PE=4 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 1.6e-15 Identity = 45/66 (68.18%), Postives = 54/66 (81.82%), Query Frame = 1
BLAST of Csa2G076020 vs. TrEMBL
Match: V7BDN3_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_007G116600g PE=4 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 1.6e-15 Identity = 45/66 (68.18%), Postives = 54/66 (81.82%), Query Frame = 1
BLAST of Csa2G076020 vs. TrEMBL
Match: A0A0S3SQ35_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.08G159600 PE=4 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 1.6e-15 Identity = 45/66 (68.18%), Postives = 54/66 (81.82%), Query Frame = 1
BLAST of Csa2G076020 vs. TrEMBL
Match: V7BGF9_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_007G116600g PE=4 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 1.6e-15 Identity = 45/66 (68.18%), Postives = 54/66 (81.82%), Query Frame = 1
BLAST of Csa2G076020 vs. TAIR10
Match: AT1G08600.3 (AT1G08600.3 P-loop containing nucleoside triphosphate hydrolases superfamily protein) HSP 1 Score: 85.9 bits (211), Expect = 1.2e-17 Identity = 42/66 (63.64%), Postives = 51/66 (77.27%), Query Frame = 1
BLAST of Csa2G076020 vs. NCBI nr
Match: gi|700206176|gb|KGN61295.1| (hypothetical protein Csa_2G076020 [Cucumis sativus]) HSP 1 Score: 154.5 bits (389), Expect = 7.7e-35 Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = 1
BLAST of Csa2G076020 vs. NCBI nr
Match: gi|951024627|ref|XP_014513464.1| (PREDICTED: protein CHROMATIN REMODELING 20 isoform X2 [Vigna radiata var. radiata]) HSP 1 Score: 89.7 bits (221), Expect = 2.3e-15 Identity = 45/66 (68.18%), Postives = 54/66 (81.82%), Query Frame = 1
BLAST of Csa2G076020 vs. NCBI nr
Match: gi|920683242|gb|KOM29987.1| (hypothetical protein LR48_Vigan845s001500 [Vigna angularis]) HSP 1 Score: 89.7 bits (221), Expect = 2.3e-15 Identity = 45/66 (68.18%), Postives = 54/66 (81.82%), Query Frame = 1
BLAST of Csa2G076020 vs. NCBI nr
Match: gi|302143565|emb|CBI22318.3| (unnamed protein product [Vitis vinifera]) HSP 1 Score: 89.7 bits (221), Expect = 2.3e-15 Identity = 44/66 (66.67%), Postives = 54/66 (81.82%), Query Frame = 1
BLAST of Csa2G076020 vs. NCBI nr
Match: gi|951024624|ref|XP_014513463.1| (PREDICTED: protein CHROMATIN REMODELING 20 isoform X1 [Vigna radiata var. radiata]) HSP 1 Score: 89.7 bits (221), Expect = 2.3e-15 Identity = 45/66 (68.18%), Postives = 54/66 (81.82%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|