Csa2G075350 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAACCTCGCAGAATCCAAACGCAAACACCAATTCCAATCCTAATACCATATCGTCGTCAATTCCTATGCTATGGCCGACCATTGATGGCTATCTGTGTTTCTCGGAGGAAGAATTGGTGAGCTATGCCCGTAGACTCTACAAATTTTGA ATGGAAACCTCGCAGAATCCAAACGCAAACACCAATTCCAATCCTAATACCATATCGTCGTCAATTCCTATGCTATGGCCGACCATTGATGGCTATCTGTGTTTCTCGGAGGAAGAATTGGTGAGCTATGCCCGTAGACTCTACAAATTTTGA ATGGAAACCTCGCAGAATCCAAACGCAAACACCAATTCCAATCCTAATACCATATCGTCGTCAATTCCTATGCTATGGCCGACCATTGATGGCTATCTGTGTTTCTCGGAGGAAGAATTGGTGAGCTATGCCCGTAGACTCTACAAATTTTGA METSQNPNANTNSNPNTISSSIPMLWPTIDGYLCFSEEELVSYARRLYKF*
BLAST of Csa2G075350 vs. Swiss-Prot
Match: PEN2_ARATH (Probable gamma-secretase subunit PEN-2 OS=Arabidopsis thaliana GN=At5g09310 PE=2 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.0e-06 Identity = 25/47 (53.19%), Postives = 28/47 (59.57%), Query Frame = 1
BLAST of Csa2G075350 vs. TrEMBL
Match: A0A0A0LMS0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G075350 PE=4 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 5.0e-21 Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = 1
BLAST of Csa2G075350 vs. TrEMBL
Match: A0A0A0LK38_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G302290 PE=4 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 6.0e-14 Identity = 41/50 (82.00%), Postives = 42/50 (84.00%), Query Frame = 1
BLAST of Csa2G075350 vs. TrEMBL
Match: G7JBL2_MEDTR (GDP-mannose transporter, putative OS=Medicago truncatula GN=MTR_3g096320 PE=2 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 5.4e-07 Identity = 30/50 (60.00%), Postives = 36/50 (72.00%), Query Frame = 1
BLAST of Csa2G075350 vs. TrEMBL
Match: W9R8E6_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_020705 PE=4 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 7.0e-07 Identity = 32/52 (61.54%), Postives = 37/52 (71.15%), Query Frame = 1
BLAST of Csa2G075350 vs. TrEMBL
Match: I1KBJ6_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_06G153700 PE=4 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 2.1e-06 Identity = 31/53 (58.49%), Postives = 37/53 (69.81%), Query Frame = 1
BLAST of Csa2G075350 vs. TAIR10
Match: AT5G09310.1 (AT5G09310.1 Gamma-secretase aspartyl protease complex, presenilin enhancer-2 subunit (InterPro:IPR019379)) HSP 1 Score: 53.1 bits (126), Expect = 5.7e-08 Identity = 25/47 (53.19%), Postives = 28/47 (59.57%), Query Frame = 1
BLAST of Csa2G075350 vs. NCBI nr
Match: gi|700206157|gb|KGN61276.1| (hypothetical protein Csa_2G075350 [Cucumis sativus]) HSP 1 Score: 107.5 bits (267), Expect = 7.2e-21 Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = 1
BLAST of Csa2G075350 vs. NCBI nr
Match: gi|659121942|ref|XP_008460893.1| (PREDICTED: probable gamma-secretase subunit PEN-2 [Cucumis melo]) HSP 1 Score: 86.7 bits (213), Expect = 1.3e-14 Identity = 41/50 (82.00%), Postives = 43/50 (86.00%), Query Frame = 1
BLAST of Csa2G075350 vs. NCBI nr
Match: gi|778670219|ref|XP_011649406.1| (PREDICTED: probable gamma-secretase subunit PEN-2 [Cucumis sativus]) HSP 1 Score: 84.0 bits (206), Expect = 8.5e-14 Identity = 41/50 (82.00%), Postives = 42/50 (84.00%), Query Frame = 1
BLAST of Csa2G075350 vs. NCBI nr
Match: gi|357464679|ref|XP_003602621.1| (GDP-mannose transporter, putative [Medicago truncatula]) HSP 1 Score: 60.8 bits (146), Expect = 7.7e-07 Identity = 30/50 (60.00%), Postives = 36/50 (72.00%), Query Frame = 1
BLAST of Csa2G075350 vs. NCBI nr
Match: gi|703078290|ref|XP_010090846.1| (hypothetical protein L484_020705 [Morus notabilis]) HSP 1 Score: 60.5 bits (145), Expect = 1.0e-06 Identity = 32/52 (61.54%), Postives = 37/52 (71.15%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|