Csa1G287000 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTCCATTAGGAGTGTTGCCGTTGTCACTTTTCTACTTGGCGTGTCCGTTATTGTATCAGAAAGCCGCGTGGCTAGAAAAGACTTGGGCCTCGACCTTGGGGGAGTGGGCCTTGGTGTTGGAACGGGAATGGGCTTGGGCTTAGGTGGAAGTGGGTCCGGGTCCGGTTCTGGGTCTGGGTCTGGGTCCAGTTCTGCTTCCTTATCACACTCCTCATACGCTGGCTCTTATGTCGGATCTGGTTCAGGCAGAAACAGGAACGGGGGGTCCGGTTCCGGTTCAGGAAGGGGAAACGGTGGAGAAGGATACGGCGAGGGTCATGGTTATGGCAATGGCGGCGAAAACTAA ATGGCTTCCATTAGGAGTGTTGCCGTTGTCACTTTTCTACTTGGCGTGTCCGTTATTGTATCAGAAAGCCGCGTGGCTAGAAAAGACTTGGGCCTCGACCTTGGGGGAGTGGGCCTTGGTGTTGGAACGGGAATGGGCTTGGGCTTAGGTGGAAGTGGGTCCGGGTCCGGTTCTGGGTCTGGGTCTGGGTCCAGTTCTGCTTCCTTATCACACTCCTCATACGCTGGCTCTTATGTCGGATCTGGTTCAGGCAGAAACAGGAACGGGGGGTCCGGTTCCGGTTCAGGAAGGGGAAACGGTGGAGAAGGATACGGCGAGGGTCATGGTTATGGCAATGGCGGCGAAAACTAA ATGGCTTCCATTAGGAGTGTTGCCGTTGTCACTTTTCTACTTGGCGTGTCCGTTATTGTATCAGAAAGCCGCGTGGCTAGAAAAGACTTGGGCCTCGACCTTGGGGGAGTGGGCCTTGGTGTTGGAACGGGAATGGGCTTGGGCTTAGGTGGAAGTGGGTCCGGGTCCGGTTCTGGGTCTGGGTCTGGGTCCAGTTCTGCTTCCTTATCACACTCCTCATACGCTGGCTCTTATGTCGGATCTGGTTCAGGCAGAAACAGGAACGGGGGGTCCGGTTCCGGTTCAGGAAGGGGAAACGGTGGAGAAGGATACGGCGAGGGTCATGGTTATGGCAATGGCGGCGAAAACTAA MASIRSVAVVTFLLGVSVIVSESRVARKDLGLDLGGVGLGVGTGMGLGLGGSGSGSGSGSGSGSSSASLSHSSYAGSYVGSGSGRNRNGGSGSGSGRGNGGEGYGEGHGYGNGGEN*
BLAST of Csa1G287000 vs. Swiss-Prot
Match: IFF6_CANAL (Cell wall protein IFF6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IFF6 PE=1 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 8.8e-14 Identity = 46/84 (54.76%), Postives = 51/84 (60.71%), Query Frame = 1
HSP 2 Score: 74.3 bits (181), Expect = 9.7e-13 Identity = 45/87 (51.72%), Postives = 51/87 (58.62%), Query Frame = 1
HSP 3 Score: 74.3 bits (181), Expect = 9.7e-13 Identity = 47/94 (50.00%), Postives = 53/94 (56.38%), Query Frame = 1
HSP 4 Score: 72.4 bits (176), Expect = 3.7e-12 Identity = 47/97 (48.45%), Postives = 52/97 (53.61%), Query Frame = 1
HSP 5 Score: 72.4 bits (176), Expect = 3.7e-12 Identity = 44/89 (49.44%), Postives = 51/89 (57.30%), Query Frame = 1
HSP 6 Score: 68.9 bits (167), Expect = 4.1e-11 Identity = 47/102 (46.08%), Postives = 54/102 (52.94%), Query Frame = 1
HSP 7 Score: 67.4 bits (163), Expect = 1.2e-10 Identity = 41/88 (46.59%), Postives = 50/88 (56.82%), Query Frame = 1
HSP 8 Score: 66.6 bits (161), Expect = 2.0e-10 Identity = 41/82 (50.00%), Postives = 47/82 (57.32%), Query Frame = 1
HSP 9 Score: 37.4 bits (85), Expect = 1.3e-01 Identity = 26/68 (38.24%), Postives = 32/68 (47.06%), Query Frame = 1
BLAST of Csa1G287000 vs. Swiss-Prot
Match: FIBH_BOMMO (Fibroin heavy chain OS=Bombyx mori GN=FIBH PE=1 SV=4) HSP 1 Score: 76.3 bits (186), Expect = 2.6e-13 Identity = 43/83 (51.81%), Postives = 50/83 (60.24%), Query Frame = 1
HSP 2 Score: 75.9 bits (185), Expect = 3.3e-13 Identity = 42/80 (52.50%), Postives = 50/80 (62.50%), Query Frame = 1
HSP 3 Score: 75.9 bits (185), Expect = 3.3e-13 Identity = 42/80 (52.50%), Postives = 50/80 (62.50%), Query Frame = 1
HSP 4 Score: 75.5 bits (184), Expect = 4.4e-13 Identity = 43/80 (53.75%), Postives = 50/80 (62.50%), Query Frame = 1
HSP 5 Score: 75.5 bits (184), Expect = 4.4e-13 Identity = 41/80 (51.25%), Postives = 52/80 (65.00%), Query Frame = 1
HSP 6 Score: 75.5 bits (184), Expect = 4.4e-13 Identity = 40/80 (50.00%), Postives = 52/80 (65.00%), Query Frame = 1
HSP 7 Score: 75.5 bits (184), Expect = 4.4e-13 Identity = 41/80 (51.25%), Postives = 52/80 (65.00%), Query Frame = 1
HSP 8 Score: 74.7 bits (182), Expect = 7.4e-13 Identity = 43/87 (49.43%), Postives = 50/87 (57.47%), Query Frame = 1
HSP 9 Score: 74.7 bits (182), Expect = 7.4e-13 Identity = 43/87 (49.43%), Postives = 50/87 (57.47%), Query Frame = 1
HSP 10 Score: 74.7 bits (182), Expect = 7.4e-13 Identity = 42/85 (49.41%), Postives = 50/85 (58.82%), Query Frame = 1
HSP 11 Score: 74.7 bits (182), Expect = 7.4e-13 Identity = 42/84 (50.00%), Postives = 50/84 (59.52%), Query Frame = 1
HSP 12 Score: 74.7 bits (182), Expect = 7.4e-13 Identity = 42/85 (49.41%), Postives = 49/85 (57.65%), Query Frame = 1
HSP 13 Score: 74.7 bits (182), Expect = 7.4e-13 Identity = 41/81 (50.62%), Postives = 50/81 (61.73%), Query Frame = 1
HSP 14 Score: 74.3 bits (181), Expect = 9.7e-13 Identity = 42/84 (50.00%), Postives = 51/84 (60.71%), Query Frame = 1
HSP 15 Score: 74.3 bits (181), Expect = 9.7e-13 Identity = 41/81 (50.62%), Postives = 49/81 (60.49%), Query Frame = 1
HSP 16 Score: 74.3 bits (181), Expect = 9.7e-13 Identity = 41/81 (50.62%), Postives = 50/81 (61.73%), Query Frame = 1
HSP 17 Score: 74.3 bits (181), Expect = 9.7e-13 Identity = 42/82 (51.22%), Postives = 49/82 (59.76%), Query Frame = 1
HSP 18 Score: 74.3 bits (181), Expect = 9.7e-13 Identity = 41/81 (50.62%), Postives = 50/81 (61.73%), Query Frame = 1
HSP 19 Score: 73.9 bits (180), Expect = 1.3e-12 Identity = 42/82 (51.22%), Postives = 48/82 (58.54%), Query Frame = 1
HSP 20 Score: 73.9 bits (180), Expect = 1.3e-12 Identity = 41/83 (49.40%), Postives = 51/83 (61.45%), Query Frame = 1
HSP 21 Score: 73.9 bits (180), Expect = 1.3e-12 Identity = 41/81 (50.62%), Postives = 50/81 (61.73%), Query Frame = 1
HSP 22 Score: 73.9 bits (180), Expect = 1.3e-12 Identity = 42/85 (49.41%), Postives = 50/85 (58.82%), Query Frame = 1
HSP 23 Score: 73.9 bits (180), Expect = 1.3e-12 Identity = 42/87 (48.28%), Postives = 49/87 (56.32%), Query Frame = 1
HSP 24 Score: 73.6 bits (179), Expect = 1.7e-12 Identity = 42/82 (51.22%), Postives = 50/82 (60.98%), Query Frame = 1
HSP 25 Score: 73.6 bits (179), Expect = 1.7e-12 Identity = 43/85 (50.59%), Postives = 49/85 (57.65%), Query Frame = 1
HSP 26 Score: 73.6 bits (179), Expect = 1.7e-12 Identity = 37/77 (48.05%), Postives = 49/77 (63.64%), Query Frame = 1
HSP 27 Score: 73.6 bits (179), Expect = 1.7e-12 Identity = 42/85 (49.41%), Postives = 50/85 (58.82%), Query Frame = 1
HSP 28 Score: 73.6 bits (179), Expect = 1.7e-12 Identity = 42/87 (48.28%), Postives = 49/87 (56.32%), Query Frame = 1
HSP 29 Score: 73.2 bits (178), Expect = 2.2e-12 Identity = 41/82 (50.00%), Postives = 50/82 (60.98%), Query Frame = 1
HSP 30 Score: 73.2 bits (178), Expect = 2.2e-12 Identity = 42/83 (50.60%), Postives = 49/83 (59.04%), Query Frame = 1
HSP 31 Score: 73.2 bits (178), Expect = 2.2e-12 Identity = 41/83 (49.40%), Postives = 49/83 (59.04%), Query Frame = 1
HSP 32 Score: 73.2 bits (178), Expect = 2.2e-12 Identity = 42/83 (50.60%), Postives = 49/83 (59.04%), Query Frame = 1
HSP 33 Score: 73.2 bits (178), Expect = 2.2e-12 Identity = 40/81 (49.38%), Postives = 50/81 (61.73%), Query Frame = 1
HSP 34 Score: 73.2 bits (178), Expect = 2.2e-12 Identity = 41/80 (51.25%), Postives = 49/80 (61.25%), Query Frame = 1
HSP 35 Score: 72.8 bits (177), Expect = 2.8e-12 Identity = 42/85 (49.41%), Postives = 49/85 (57.65%), Query Frame = 1
HSP 36 Score: 72.8 bits (177), Expect = 2.8e-12 Identity = 41/85 (48.24%), Postives = 50/85 (58.82%), Query Frame = 1
HSP 37 Score: 72.4 bits (176), Expect = 3.7e-12 Identity = 40/80 (50.00%), Postives = 49/80 (61.25%), Query Frame = 1
HSP 38 Score: 72.4 bits (176), Expect = 3.7e-12 Identity = 42/85 (49.41%), Postives = 48/85 (56.47%), Query Frame = 1
HSP 39 Score: 72.4 bits (176), Expect = 3.7e-12 Identity = 41/84 (48.81%), Postives = 49/84 (58.33%), Query Frame = 1
HSP 40 Score: 72.4 bits (176), Expect = 3.7e-12 Identity = 43/93 (46.24%), Postives = 49/93 (52.69%), Query Frame = 1
HSP 41 Score: 72.0 bits (175), Expect = 4.8e-12 Identity = 40/83 (48.19%), Postives = 50/83 (60.24%), Query Frame = 1
HSP 42 Score: 72.0 bits (175), Expect = 4.8e-12 Identity = 40/83 (48.19%), Postives = 50/83 (60.24%), Query Frame = 1
HSP 43 Score: 72.0 bits (175), Expect = 4.8e-12 Identity = 40/81 (49.38%), Postives = 50/81 (61.73%), Query Frame = 1
HSP 44 Score: 72.0 bits (175), Expect = 4.8e-12 Identity = 41/85 (48.24%), Postives = 50/85 (58.82%), Query Frame = 1
HSP 45 Score: 72.0 bits (175), Expect = 4.8e-12 Identity = 41/85 (48.24%), Postives = 49/85 (57.65%), Query Frame = 1
HSP 46 Score: 72.0 bits (175), Expect = 4.8e-12 Identity = 40/83 (48.19%), Postives = 50/83 (60.24%), Query Frame = 1
HSP 47 Score: 72.0 bits (175), Expect = 4.8e-12 Identity = 41/85 (48.24%), Postives = 48/85 (56.47%), Query Frame = 1
HSP 48 Score: 72.0 bits (175), Expect = 4.8e-12 Identity = 41/80 (51.25%), Postives = 50/80 (62.50%), Query Frame = 1
HSP 49 Score: 72.0 bits (175), Expect = 4.8e-12 Identity = 39/80 (48.75%), Postives = 50/80 (62.50%), Query Frame = 1
HSP 50 Score: 71.6 bits (174), Expect = 6.3e-12 Identity = 40/81 (49.38%), Postives = 50/81 (61.73%), Query Frame = 1
HSP 51 Score: 71.6 bits (174), Expect = 6.3e-12 Identity = 39/80 (48.75%), Postives = 49/80 (61.25%), Query Frame = 1
HSP 52 Score: 71.6 bits (174), Expect = 6.3e-12 Identity = 41/85 (48.24%), Postives = 50/85 (58.82%), Query Frame = 1
HSP 53 Score: 71.6 bits (174), Expect = 6.3e-12 Identity = 39/81 (48.15%), Postives = 48/81 (59.26%), Query Frame = 1
HSP 54 Score: 71.6 bits (174), Expect = 6.3e-12 Identity = 41/85 (48.24%), Postives = 49/85 (57.65%), Query Frame = 1
HSP 55 Score: 71.2 bits (173), Expect = 8.2e-12 Identity = 41/85 (48.24%), Postives = 48/85 (56.47%), Query Frame = 1
HSP 56 Score: 71.2 bits (173), Expect = 8.2e-12 Identity = 41/81 (50.62%), Postives = 48/81 (59.26%), Query Frame = 1
HSP 57 Score: 71.2 bits (173), Expect = 8.2e-12 Identity = 41/81 (50.62%), Postives = 49/81 (60.49%), Query Frame = 1
HSP 58 Score: 71.2 bits (173), Expect = 8.2e-12 Identity = 40/80 (50.00%), Postives = 49/80 (61.25%), Query Frame = 1
HSP 59 Score: 71.2 bits (173), Expect = 8.2e-12 Identity = 43/99 (43.43%), Postives = 51/99 (51.52%), Query Frame = 1
HSP 60 Score: 70.9 bits (172), Expect = 1.1e-11 Identity = 40/81 (49.38%), Postives = 49/81 (60.49%), Query Frame = 1
HSP 61 Score: 70.9 bits (172), Expect = 1.1e-11 Identity = 39/83 (46.99%), Postives = 49/83 (59.04%), Query Frame = 1
HSP 62 Score: 70.9 bits (172), Expect = 1.1e-11 Identity = 41/84 (48.81%), Postives = 49/84 (58.33%), Query Frame = 1
HSP 63 Score: 70.9 bits (172), Expect = 1.1e-11 Identity = 38/80 (47.50%), Postives = 48/80 (60.00%), Query Frame = 1
HSP 64 Score: 70.9 bits (172), Expect = 1.1e-11 Identity = 40/85 (47.06%), Postives = 48/85 (56.47%), Query Frame = 1
HSP 65 Score: 70.9 bits (172), Expect = 1.1e-11 Identity = 41/84 (48.81%), Postives = 49/84 (58.33%), Query Frame = 1
HSP 66 Score: 70.9 bits (172), Expect = 1.1e-11 Identity = 41/82 (50.00%), Postives = 48/82 (58.54%), Query Frame = 1
HSP 67 Score: 70.9 bits (172), Expect = 1.1e-11 Identity = 39/80 (48.75%), Postives = 50/80 (62.50%), Query Frame = 1
HSP 68 Score: 70.9 bits (172), Expect = 1.1e-11 Identity = 42/91 (46.15%), Postives = 49/91 (53.85%), Query Frame = 1
HSP 69 Score: 70.5 bits (171), Expect = 1.4e-11 Identity = 40/80 (50.00%), Postives = 50/80 (62.50%), Query Frame = 1
HSP 70 Score: 70.5 bits (171), Expect = 1.4e-11 Identity = 41/89 (46.07%), Postives = 48/89 (53.93%), Query Frame = 1
HSP 71 Score: 70.5 bits (171), Expect = 1.4e-11 Identity = 40/81 (49.38%), Postives = 49/81 (60.49%), Query Frame = 1
HSP 72 Score: 70.5 bits (171), Expect = 1.4e-11 Identity = 40/84 (47.62%), Postives = 50/84 (59.52%), Query Frame = 1
HSP 73 Score: 70.5 bits (171), Expect = 1.4e-11 Identity = 39/82 (47.56%), Postives = 51/82 (62.20%), Query Frame = 1
HSP 74 Score: 70.5 bits (171), Expect = 1.4e-11 Identity = 41/84 (48.81%), Postives = 49/84 (58.33%), Query Frame = 1
HSP 75 Score: 70.5 bits (171), Expect = 1.4e-11 Identity = 40/83 (48.19%), Postives = 50/83 (60.24%), Query Frame = 1
HSP 76 Score: 70.5 bits (171), Expect = 1.4e-11 Identity = 40/80 (50.00%), Postives = 48/80 (60.00%), Query Frame = 1
HSP 77 Score: 70.1 bits (170), Expect = 1.8e-11 Identity = 39/80 (48.75%), Postives = 48/80 (60.00%), Query Frame = 1
HSP 78 Score: 70.1 bits (170), Expect = 1.8e-11 Identity = 39/80 (48.75%), Postives = 48/80 (60.00%), Query Frame = 1
HSP 79 Score: 70.1 bits (170), Expect = 1.8e-11 Identity = 41/89 (46.07%), Postives = 51/89 (57.30%), Query Frame = 1
HSP 80 Score: 70.1 bits (170), Expect = 1.8e-11 Identity = 42/89 (47.19%), Postives = 51/89 (57.30%), Query Frame = 1
HSP 81 Score: 70.1 bits (170), Expect = 1.8e-11 Identity = 40/80 (50.00%), Postives = 47/80 (58.75%), Query Frame = 1
HSP 82 Score: 70.1 bits (170), Expect = 1.8e-11 Identity = 40/86 (46.51%), Postives = 51/86 (59.30%), Query Frame = 1
HSP 83 Score: 70.1 bits (170), Expect = 1.8e-11 Identity = 40/82 (48.78%), Postives = 49/82 (59.76%), Query Frame = 1
HSP 84 Score: 70.1 bits (170), Expect = 1.8e-11 Identity = 40/82 (48.78%), Postives = 49/82 (59.76%), Query Frame = 1
HSP 85 Score: 70.1 bits (170), Expect = 1.8e-11 Identity = 40/85 (47.06%), Postives = 48/85 (56.47%), Query Frame = 1
HSP 86 Score: 70.1 bits (170), Expect = 1.8e-11 Identity = 40/83 (48.19%), Postives = 48/83 (57.83%), Query Frame = 1
HSP 87 Score: 69.7 bits (169), Expect = 2.4e-11 Identity = 40/87 (45.98%), Postives = 51/87 (58.62%), Query Frame = 1
HSP 88 Score: 69.7 bits (169), Expect = 2.4e-11 Identity = 38/78 (48.72%), Postives = 49/78 (62.82%), Query Frame = 1
HSP 89 Score: 69.7 bits (169), Expect = 2.4e-11 Identity = 41/85 (48.24%), Postives = 49/85 (57.65%), Query Frame = 1
HSP 90 Score: 69.3 bits (168), Expect = 3.1e-11 Identity = 41/91 (45.05%), Postives = 51/91 (56.04%), Query Frame = 1
HSP 91 Score: 69.3 bits (168), Expect = 3.1e-11 Identity = 39/85 (45.88%), Postives = 49/85 (57.65%), Query Frame = 1
HSP 92 Score: 69.3 bits (168), Expect = 3.1e-11 Identity = 39/82 (47.56%), Postives = 48/82 (58.54%), Query Frame = 1
HSP 93 Score: 69.3 bits (168), Expect = 3.1e-11 Identity = 39/85 (45.88%), Postives = 49/85 (57.65%), Query Frame = 1
HSP 94 Score: 69.3 bits (168), Expect = 3.1e-11 Identity = 39/82 (47.56%), Postives = 49/82 (59.76%), Query Frame = 1
HSP 95 Score: 68.9 bits (167), Expect = 4.1e-11 Identity = 41/94 (43.62%), Postives = 52/94 (55.32%), Query Frame = 1
HSP 96 Score: 68.9 bits (167), Expect = 4.1e-11 Identity = 40/82 (48.78%), Postives = 49/82 (59.76%), Query Frame = 1
HSP 97 Score: 68.6 bits (166), Expect = 5.3e-11 Identity = 39/85 (45.88%), Postives = 49/85 (57.65%), Query Frame = 1
HSP 98 Score: 68.6 bits (166), Expect = 5.3e-11 Identity = 38/81 (46.91%), Postives = 50/81 (61.73%), Query Frame = 1
HSP 99 Score: 68.6 bits (166), Expect = 5.3e-11 Identity = 39/80 (48.75%), Postives = 47/80 (58.75%), Query Frame = 1
HSP 100 Score: 68.6 bits (166), Expect = 5.3e-11 Identity = 38/79 (48.10%), Postives = 49/79 (62.03%), Query Frame = 1
HSP 101 Score: 68.2 bits (165), Expect = 7.0e-11 Identity = 39/81 (48.15%), Postives = 47/81 (58.02%), Query Frame = 1
HSP 102 Score: 68.2 bits (165), Expect = 7.0e-11 Identity = 39/85 (45.88%), Postives = 48/85 (56.47%), Query Frame = 1
HSP 103 Score: 68.2 bits (165), Expect = 7.0e-11 Identity = 36/80 (45.00%), Postives = 46/80 (57.50%), Query Frame = 1
HSP 104 Score: 68.2 bits (165), Expect = 7.0e-11 Identity = 39/86 (45.35%), Postives = 49/86 (56.98%), Query Frame = 1
HSP 105 Score: 67.8 bits (164), Expect = 9.1e-11 Identity = 38/80 (47.50%), Postives = 47/80 (58.75%), Query Frame = 1
HSP 106 Score: 67.8 bits (164), Expect = 9.1e-11 Identity = 38/80 (47.50%), Postives = 47/80 (58.75%), Query Frame = 1
HSP 107 Score: 67.8 bits (164), Expect = 9.1e-11 Identity = 40/84 (47.62%), Postives = 48/84 (57.14%), Query Frame = 1
HSP 108 Score: 67.8 bits (164), Expect = 9.1e-11 Identity = 41/87 (47.13%), Postives = 48/87 (55.17%), Query Frame = 1
HSP 109 Score: 67.8 bits (164), Expect = 9.1e-11 Identity = 41/87 (47.13%), Postives = 48/87 (55.17%), Query Frame = 1
HSP 110 Score: 67.4 bits (163), Expect = 1.2e-10 Identity = 36/84 (42.86%), Postives = 48/84 (57.14%), Query Frame = 1
HSP 111 Score: 67.4 bits (163), Expect = 1.2e-10 Identity = 39/80 (48.75%), Postives = 49/80 (61.25%), Query Frame = 1
HSP 112 Score: 67.4 bits (163), Expect = 1.2e-10 Identity = 38/81 (46.91%), Postives = 48/81 (59.26%), Query Frame = 1
HSP 113 Score: 67.4 bits (163), Expect = 1.2e-10 Identity = 38/81 (46.91%), Postives = 49/81 (60.49%), Query Frame = 1
HSP 114 Score: 67.0 bits (162), Expect = 1.6e-10 Identity = 38/80 (47.50%), Postives = 47/80 (58.75%), Query Frame = 1
HSP 115 Score: 66.6 bits (161), Expect = 2.0e-10 Identity = 37/82 (45.12%), Postives = 48/82 (58.54%), Query Frame = 1
HSP 116 Score: 66.2 bits (160), Expect = 2.6e-10 Identity = 38/83 (45.78%), Postives = 46/83 (55.42%), Query Frame = 1
HSP 117 Score: 66.2 bits (160), Expect = 2.6e-10 Identity = 32/72 (44.44%), Postives = 44/72 (61.11%), Query Frame = 1
HSP 118 Score: 66.2 bits (160), Expect = 2.6e-10 Identity = 38/81 (46.91%), Postives = 48/81 (59.26%), Query Frame = 1
HSP 119 Score: 66.2 bits (160), Expect = 2.6e-10 Identity = 37/80 (46.25%), Postives = 50/80 (62.50%), Query Frame = 1
HSP 120 Score: 66.2 bits (160), Expect = 2.6e-10 Identity = 39/81 (48.15%), Postives = 47/81 (58.02%), Query Frame = 1
HSP 121 Score: 66.2 bits (160), Expect = 2.6e-10 Identity = 41/100 (41.00%), Postives = 51/100 (51.00%), Query Frame = 1
HSP 122 Score: 65.9 bits (159), Expect = 3.5e-10 Identity = 38/80 (47.50%), Postives = 46/80 (57.50%), Query Frame = 1
HSP 123 Score: 65.9 bits (159), Expect = 3.5e-10 Identity = 40/91 (43.96%), Postives = 49/91 (53.85%), Query Frame = 1
HSP 124 Score: 65.9 bits (159), Expect = 3.5e-10 Identity = 41/102 (40.20%), Postives = 52/102 (50.98%), Query Frame = 1
HSP 125 Score: 65.5 bits (158), Expect = 4.5e-10 Identity = 37/82 (45.12%), Postives = 46/82 (56.10%), Query Frame = 1
HSP 126 Score: 65.5 bits (158), Expect = 4.5e-10 Identity = 38/81 (46.91%), Postives = 46/81 (56.79%), Query Frame = 1
HSP 127 Score: 65.5 bits (158), Expect = 4.5e-10 Identity = 36/80 (45.00%), Postives = 46/80 (57.50%), Query Frame = 1
HSP 128 Score: 65.1 bits (157), Expect = 5.9e-10 Identity = 37/87 (42.53%), Postives = 49/87 (56.32%), Query Frame = 1
HSP 129 Score: 65.1 bits (157), Expect = 5.9e-10 Identity = 38/92 (41.30%), Postives = 48/92 (52.17%), Query Frame = 1
HSP 130 Score: 65.1 bits (157), Expect = 5.9e-10 Identity = 40/101 (39.60%), Postives = 51/101 (50.50%), Query Frame = 1
HSP 131 Score: 65.1 bits (157), Expect = 5.9e-10 Identity = 38/82 (46.34%), Postives = 46/82 (56.10%), Query Frame = 1
HSP 132 Score: 64.3 bits (155), Expect = 1.0e-09 Identity = 32/72 (44.44%), Postives = 42/72 (58.33%), Query Frame = 1
HSP 133 Score: 64.3 bits (155), Expect = 1.0e-09 Identity = 34/80 (42.50%), Postives = 46/80 (57.50%), Query Frame = 1
HSP 134 Score: 63.9 bits (154), Expect = 1.3e-09 Identity = 38/90 (42.22%), Postives = 49/90 (54.44%), Query Frame = 1
HSP 135 Score: 63.5 bits (153), Expect = 1.7e-09 Identity = 36/83 (43.37%), Postives = 46/83 (55.42%), Query Frame = 1
HSP 136 Score: 63.5 bits (153), Expect = 1.7e-09 Identity = 36/92 (39.13%), Postives = 47/92 (51.09%), Query Frame = 1
HSP 137 Score: 62.4 bits (150), Expect = 3.8e-09 Identity = 41/111 (36.94%), Postives = 51/111 (45.95%), Query Frame = 1
HSP 138 Score: 61.6 bits (148), Expect = 6.5e-09 Identity = 35/83 (42.17%), Postives = 45/83 (54.22%), Query Frame = 1
HSP 139 Score: 59.7 bits (143), Expect = 2.5e-08 Identity = 34/91 (37.36%), Postives = 48/91 (52.75%), Query Frame = 1
HSP 140 Score: 58.5 bits (140), Expect = 5.5e-08 Identity = 31/80 (38.75%), Postives = 41/80 (51.25%), Query Frame = 1
HSP 141 Score: 58.5 bits (140), Expect = 5.5e-08 Identity = 31/80 (38.75%), Postives = 41/80 (51.25%), Query Frame = 1
BLAST of Csa1G287000 vs. Swiss-Prot
Match: GRP2_ORYSI (Glycine-rich cell wall structural protein 2 OS=Oryza sativa subsp. indica GN=GRP0.9 PE=2 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.7e-12 Identity = 48/116 (41.38%), Postives = 59/116 (50.86%), Query Frame = 1
HSP 2 Score: 67.8 bits (164), Expect = 9.1e-11 Identity = 49/138 (35.51%), Postives = 60/138 (43.48%), Query Frame = 1
HSP 3 Score: 66.2 bits (160), Expect = 2.6e-10 Identity = 42/83 (50.60%), Postives = 43/83 (51.81%), Query Frame = 1
BLAST of Csa1G287000 vs. Swiss-Prot
Match: GRP2_ORYSJ (Glycine-rich cell wall structural protein 2 OS=Oryza sativa subsp. japonica GN=GRP0.9 PE=2 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.7e-12 Identity = 48/116 (41.38%), Postives = 59/116 (50.86%), Query Frame = 1
HSP 2 Score: 67.8 bits (164), Expect = 9.1e-11 Identity = 49/138 (35.51%), Postives = 60/138 (43.48%), Query Frame = 1
HSP 3 Score: 66.2 bits (160), Expect = 2.6e-10 Identity = 42/83 (50.60%), Postives = 43/83 (51.81%), Query Frame = 1
BLAST of Csa1G287000 vs. Swiss-Prot
Match: PHXR5_MOUSE (Putative per-hexamer repeat protein 5 OS=Mus musculus GN=Phxr5 PE=5 SV=2) HSP 1 Score: 71.6 bits (174), Expect = 6.3e-12 Identity = 45/93 (48.39%), Postives = 50/93 (53.76%), Query Frame = 1
HSP 2 Score: 70.9 bits (172), Expect = 1.1e-11 Identity = 46/97 (47.42%), Postives = 50/97 (51.55%), Query Frame = 1
HSP 3 Score: 70.1 bits (170), Expect = 1.8e-11 Identity = 42/75 (56.00%), Postives = 43/75 (57.33%), Query Frame = 1
HSP 4 Score: 69.7 bits (169), Expect = 2.4e-11 Identity = 45/97 (46.39%), Postives = 51/97 (52.58%), Query Frame = 1
HSP 5 Score: 68.2 bits (165), Expect = 7.0e-11 Identity = 36/85 (42.35%), Postives = 50/85 (58.82%), Query Frame = 1
HSP 6 Score: 67.0 bits (162), Expect = 1.6e-10 Identity = 44/98 (44.90%), Postives = 48/98 (48.98%), Query Frame = 1
HSP 7 Score: 66.2 bits (160), Expect = 2.6e-10 Identity = 38/95 (40.00%), Postives = 51/95 (53.68%), Query Frame = 1
HSP 8 Score: 64.3 bits (155), Expect = 1.0e-09 Identity = 37/80 (46.25%), Postives = 47/80 (58.75%), Query Frame = 1
HSP 9 Score: 62.8 bits (151), Expect = 2.9e-09 Identity = 37/92 (40.22%), Postives = 49/92 (53.26%), Query Frame = 1
HSP 10 Score: 61.6 bits (148), Expect = 6.5e-09 Identity = 43/105 (40.95%), Postives = 48/105 (45.71%), Query Frame = 1
HSP 11 Score: 60.1 bits (144), Expect = 1.9e-08 Identity = 33/91 (36.26%), Postives = 47/91 (51.65%), Query Frame = 1
HSP 12 Score: 58.5 bits (140), Expect = 5.5e-08 Identity = 36/83 (43.37%), Postives = 47/83 (56.63%), Query Frame = 1
HSP 13 Score: 57.8 bits (138), Expect = 9.4e-08 Identity = 34/88 (38.64%), Postives = 44/88 (50.00%), Query Frame = 1
HSP 14 Score: 57.4 bits (137), Expect = 1.2e-07 Identity = 36/93 (38.71%), Postives = 48/93 (51.61%), Query Frame = 1
HSP 15 Score: 57.0 bits (136), Expect = 1.6e-07 Identity = 37/105 (35.24%), Postives = 50/105 (47.62%), Query Frame = 1
HSP 16 Score: 56.2 bits (134), Expect = 2.7e-07 Identity = 32/84 (38.10%), Postives = 47/84 (55.95%), Query Frame = 1
HSP 17 Score: 55.5 bits (132), Expect = 4.7e-07 Identity = 35/97 (36.08%), Postives = 50/97 (51.55%), Query Frame = 1
HSP 18 Score: 53.5 bits (127), Expect = 1.8e-06 Identity = 34/112 (30.36%), Postives = 54/112 (48.21%), Query Frame = 1
HSP 19 Score: 50.4 bits (119), Expect = 1.5e-05 Identity = 29/82 (35.37%), Postives = 43/82 (52.44%), Query Frame = 1
HSP 20 Score: 49.3 bits (116), Expect = 3.3e-05 Identity = 34/107 (31.78%), Postives = 46/107 (42.99%), Query Frame = 1
HSP 21 Score: 45.4 bits (106), Expect = 4.8e-04 Identity = 29/81 (35.80%), Postives = 45/81 (55.56%), Query Frame = 1
HSP 22 Score: 41.6 bits (96), Expect = 7.0e-03 Identity = 26/78 (33.33%), Postives = 37/78 (47.44%), Query Frame = 1
HSP 23 Score: 41.2 bits (95), Expect = 9.1e-03 Identity = 33/99 (33.33%), Postives = 47/99 (47.47%), Query Frame = 1
HSP 24 Score: 37.7 bits (86), Expect = 1.0e-01 Identity = 23/78 (29.49%), Postives = 39/78 (50.00%), Query Frame = 1
BLAST of Csa1G287000 vs. TrEMBL
Match: A0A0A0LTK9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G278500 PE=4 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 3.1e-34 Identity = 87/146 (59.59%), Postives = 96/146 (65.75%), Query Frame = 1
BLAST of Csa1G287000 vs. TrEMBL
Match: F6HS59_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_05s0051g00680 PE=4 SV=1) HSP 1 Score: 140.2 bits (352), Expect = 1.6e-30 Identity = 80/149 (53.69%), Postives = 95/149 (63.76%), Query Frame = 1
BLAST of Csa1G287000 vs. TrEMBL
Match: F6HS59_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_05s0051g00680 PE=4 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.1e-07 Identity = 40/78 (51.28%), Postives = 41/78 (52.56%), Query Frame = 1
HSP 2 Score: 139.8 bits (351), Expect = 2.1e-30 Identity = 81/151 (53.64%), Postives = 95/151 (62.91%), Query Frame = 1
BLAST of Csa1G287000 vs. TrEMBL
Match: A5AIY9_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_013093 PE=4 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.1e-07 Identity = 40/78 (51.28%), Postives = 41/78 (52.56%), Query Frame = 1
HSP 2 Score: 132.5 bits (332), Expect = 3.3e-28 Identity = 75/127 (59.06%), Postives = 90/127 (70.87%), Query Frame = 1
BLAST of Csa1G287000 vs. TrEMBL
Match: A0A151S9D6_CAJCA (Uncharacterized protein OS=Cajanus cajan GN=KK1_026719 PE=4 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 4.4e-28 Identity = 76/143 (53.15%), Postives = 91/143 (63.64%), Query Frame = 1
BLAST of Csa1G287000 vs. TAIR10
Match: AT4G30460.1 (AT4G30460.1 glycine-rich protein) HSP 1 Score: 126.7 bits (317), Expect = 9.3e-30 Identity = 77/148 (52.03%), Postives = 88/148 (59.46%), Query Frame = 1
BLAST of Csa1G287000 vs. TAIR10
Match: AT4G30450.1 (AT4G30450.1 glycine-rich protein) HSP 1 Score: 99.8 bits (247), Expect = 1.2e-21 Identity = 54/97 (55.67%), Postives = 69/97 (71.13%), Query Frame = 1
BLAST of Csa1G287000 vs. TAIR10
Match: AT4G36230.1 (AT4G36230.1 unknown protein) HSP 1 Score: 74.3 bits (181), Expect = 5.5e-14 Identity = 40/79 (50.63%), Postives = 41/79 (51.90%), Query Frame = 1
HSP 2 Score: 64.7 bits (156), Expect = 4.3e-11 Identity = 41/91 (45.05%), Postives = 41/91 (45.05%), Query Frame = 1
HSP 3 Score: 28.5 bits (62), Expect = 3.4e+00 Identity = 17/30 (56.67%), Postives = 15/30 (50.00%), Query Frame = 1
HSP 4 Score: 23.9 bits (50), Expect = 8.5e+01 Identity = 12/28 (42.86%), Postives = 12/28 (42.86%), Query Frame = 1
BLAST of Csa1G287000 vs. TAIR10
Match: AT4G01985.1 (AT4G01985.1 unknown protein) HSP 1 Score: 67.4 bits (163), Expect = 6.7e-12 Identity = 37/81 (45.68%), Postives = 42/81 (51.85%), Query Frame = 1
HSP 2 Score: 58.2 bits (139), Expect = 4.1e-09 Identity = 37/87 (42.53%), Postives = 40/87 (45.98%), Query Frame = 1
HSP 3 Score: 57.8 bits (138), Expect = 5.3e-09 Identity = 39/91 (42.86%), Postives = 42/91 (46.15%), Query Frame = 1
HSP 4 Score: 55.8 bits (133), Expect = 2.0e-08 Identity = 34/81 (41.98%), Postives = 39/81 (48.15%), Query Frame = 1
HSP 5 Score: 55.5 bits (132), Expect = 2.6e-08 Identity = 39/109 (35.78%), Postives = 47/109 (43.12%), Query Frame = 1
HSP 6 Score: 55.5 bits (132), Expect = 2.6e-08 Identity = 39/86 (45.35%), Postives = 41/86 (47.67%), Query Frame = 1
HSP 7 Score: 55.1 bits (131), Expect = 3.4e-08 Identity = 34/80 (42.50%), Postives = 39/80 (48.75%), Query Frame = 1
HSP 8 Score: 54.7 bits (130), Expect = 4.5e-08 Identity = 32/88 (36.36%), Postives = 36/88 (40.91%), Query Frame = 1
HSP 9 Score: 53.5 bits (127), Expect = 1.0e-07 Identity = 34/80 (42.50%), Postives = 39/80 (48.75%), Query Frame = 1
HSP 10 Score: 52.4 bits (124), Expect = 2.2e-07 Identity = 34/83 (40.96%), Postives = 34/83 (40.96%), Query Frame = 1
HSP 11 Score: 50.1 bits (118), Expect = 1.1e-06 Identity = 33/87 (37.93%), Postives = 36/87 (41.38%), Query Frame = 1
HSP 12 Score: 48.5 bits (114), Expect = 3.2e-06 Identity = 34/100 (34.00%), Postives = 40/100 (40.00%), Query Frame = 1
HSP 13 Score: 43.9 bits (102), Expect = 7.9e-05 Identity = 27/73 (36.99%), Postives = 33/73 (45.21%), Query Frame = 1
BLAST of Csa1G287000 vs. TAIR10
Match: AT3G16460.1 (AT3G16460.1 Mannose-binding lectin superfamily protein) HSP 1 Score: 67.4 bits (163), Expect = 6.7e-12 Identity = 35/93 (37.63%), Postives = 52/93 (55.91%), Query Frame = 1
HSP 2 Score: 64.7 bits (156), Expect = 4.3e-11 Identity = 30/74 (40.54%), Postives = 41/74 (55.41%), Query Frame = 1
HSP 3 Score: 63.2 bits (152), Expect = 1.3e-10 Identity = 34/93 (36.56%), Postives = 45/93 (48.39%), Query Frame = 1
HSP 4 Score: 48.9 bits (115), Expect = 2.5e-06 Identity = 25/75 (33.33%), Postives = 36/75 (48.00%), Query Frame = 1
HSP 5 Score: 47.8 bits (112), Expect = 5.5e-06 Identity = 25/82 (30.49%), Postives = 37/82 (45.12%), Query Frame = 1
HSP 6 Score: 45.4 bits (106), Expect = 2.7e-05 Identity = 24/74 (32.43%), Postives = 33/74 (44.59%), Query Frame = 1
BLAST of Csa1G287000 vs. NCBI nr
Match: gi|778660326|ref|XP_004146660.2| (PREDICTED: glycine-rich cell wall structural protein 2 [Cucumis sativus]) HSP 1 Score: 152.5 bits (384), Expect = 4.5e-34 Identity = 87/146 (59.59%), Postives = 96/146 (65.75%), Query Frame = 1
BLAST of Csa1G287000 vs. NCBI nr
Match: gi|659086209|ref|XP_008443813.1| (PREDICTED: glycine-rich cell wall structural protein 2-like [Cucumis melo]) HSP 1 Score: 149.8 bits (377), Expect = 2.9e-33 Identity = 86/145 (59.31%), Postives = 95/145 (65.52%), Query Frame = 1
BLAST of Csa1G287000 vs. NCBI nr
Match: gi|147775987|emb|CAN75720.1| (hypothetical protein VITISV_013093 [Vitis vinifera]) HSP 1 Score: 139.8 bits (351), Expect = 3.0e-30 Identity = 81/151 (53.64%), Postives = 95/151 (62.91%), Query Frame = 1
BLAST of Csa1G287000 vs. NCBI nr
Match: gi|147775987|emb|CAN75720.1| (hypothetical protein VITISV_013093 [Vitis vinifera]) HSP 1 Score: 64.3 bits (155), Expect = 1.6e-07 Identity = 40/78 (51.28%), Postives = 41/78 (52.56%), Query Frame = 1
HSP 2 Score: 137.5 bits (345), Expect = 1.5e-29 Identity = 78/141 (55.32%), Postives = 92/141 (65.25%), Query Frame = 1
BLAST of Csa1G287000 vs. NCBI nr
Match: gi|566215231|ref|XP_006372107.1| (hypothetical protein POPTR_0018s10920g [Populus trichocarpa]) HSP 1 Score: 48.5 bits (114), Expect = 9.1e-03 Identity = 34/79 (43.04%), Postives = 39/79 (49.37%), Query Frame = 1
HSP 2 Score: 134.8 bits (338), Expect = 9.7e-29 Identity = 68/113 (60.18%), Postives = 83/113 (73.45%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |