Csa1G096630 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGGTCGCTTCATTAGATTACGGTAACCAATTGAAGAATCGGAGAGATGGAATCGTTGAGAGGCTCTACGCGTTGACTTCGCCGCCATCTCGATGTCGGAACTGTGATACGGATCGCAACCATGACGGTCGCTCTAATGGCTGTGAAATCAAACAGGGGTCAGGTGAGTATATATATATATATAATATTATTATACGCACTAAAAAGTTGTAATATTATTTCTAAAGTTTCGTAAATGTTTCAAATTTTAGTTTTAAGTCATGCAAAACTATTTAGATGCCAATTCTCAATGA ATGGAGGTCGCTTCATTAGATTACGGTAACCAATTGAAGAATCGGAGAGATGGAATCGTTGAGAGGCTCTACGCGTTGACTTCGCCGCCATCTCGATGTCGGAACTGTGATACGGATCGCAACCATGACGGTCGCTCTAATGGCTGTGAAATCAAACAGGGGTCAGATGCCAATTCTCAATGA ATGGAGGTCGCTTCATTAGATTACGGTAACCAATTGAAGAATCGGAGAGATGGAATCGTTGAGAGGCTCTACGCGTTGACTTCGCCGCCATCTCGATGTCGGAACTGTGATACGGATCGCAACCATGACGGTCGCTCTAATGGCTGTGAAATCAAACAGGGGTCAGATGCCAATTCTCAATGA MEVASLDYGNQLKNRRDGIVERLYALTSPPSRCRNCDTDRNHDGRSNGCEIKQGSDANSQ*
BLAST of Csa1G096630 vs. Swiss-Prot
Match: MD26C_ARATH (Probable mediator of RNA polymerase II transcription subunit 26c OS=Arabidopsis thaliana GN=MED26C PE=1 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 9.3e-07 Identity = 26/35 (74.29%), Postives = 27/35 (77.14%), Query Frame = 1
BLAST of Csa1G096630 vs. TrEMBL
Match: A0A0A0LXQ9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G096630 PE=4 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 1.9e-27 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of Csa1G096630 vs. TrEMBL
Match: A0A0A0KHV9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G486670 PE=4 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 1.5e-24 Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 1
BLAST of Csa1G096630 vs. TrEMBL
Match: M5WBR6_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa008362mg PE=4 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 1.3e-07 Identity = 29/46 (63.04%), Postives = 34/46 (73.91%), Query Frame = 1
BLAST of Csa1G096630 vs. TrEMBL
Match: A0A151TLA9_CAJCA (Uncharacterized protein OS=Cajanus cajan GN=KK1_024173 PE=4 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 3.2e-06 Identity = 25/37 (67.57%), Postives = 31/37 (83.78%), Query Frame = 1
BLAST of Csa1G096630 vs. TrEMBL
Match: A0A061FYN3_THECC (Transcription elongation factor (TFIIS) family protein, putative isoform 1 OS=Theobroma cacao GN=TCM_045322 PE=4 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 5.5e-06 Identity = 33/54 (61.11%), Postives = 40/54 (74.07%), Query Frame = 1
BLAST of Csa1G096630 vs. TAIR10
Match: AT5G09850.1 (AT5G09850.1 Transcription elongation factor (TFIIS) family protein) HSP 1 Score: 53.5 bits (127), Expect = 5.2e-08 Identity = 26/35 (74.29%), Postives = 27/35 (77.14%), Query Frame = 1
BLAST of Csa1G096630 vs. NCBI nr
Match: gi|700209685|gb|KGN64781.1| (hypothetical protein Csa_1G096630 [Cucumis sativus]) HSP 1 Score: 129.0 bits (323), Expect = 2.8e-27 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of Csa1G096630 vs. NCBI nr
Match: gi|659080819|ref|XP_008440997.1| (PREDICTED: probable mediator of RNA polymerase II transcription subunit 26c [Cucumis melo]) HSP 1 Score: 119.4 bits (298), Expect = 2.2e-24 Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 1
BLAST of Csa1G096630 vs. NCBI nr
Match: gi|449448454|ref|XP_004141981.1| (PREDICTED: probable mediator of RNA polymerase II transcription subunit 26c [Cucumis sativus]) HSP 1 Score: 119.4 bits (298), Expect = 2.2e-24 Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 1
BLAST of Csa1G096630 vs. NCBI nr
Match: gi|1012257508|ref|XP_015945225.1| (PREDICTED: probable mediator of RNA polymerase II transcription subunit 26c [Arachis duranensis]) HSP 1 Score: 67.4 bits (163), Expect = 9.9e-09 Identity = 32/51 (62.75%), Postives = 41/51 (80.39%), Query Frame = 1
BLAST of Csa1G096630 vs. NCBI nr
Match: gi|1021581102|ref|XP_016179913.1| (PREDICTED: probable mediator of RNA polymerase II transcription subunit 26c [Arachis ipaensis]) HSP 1 Score: 67.0 bits (162), Expect = 1.3e-08 Identity = 32/51 (62.75%), Postives = 41/51 (80.39%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|