Csa1G025820 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTATGTATATATATTCTCGAAAAACAAGGTATATACTGATCTTAAAGACGGCAAATCACATATAGTCAATACTTCTTGGGTGCTGTTGGCTCTCATTCAAACCGATCAGGTATTAGTTTCATTAATTTCATCGACTTTTGATATGATAAATTATTCAACTATGCTTGTACGTGTTTAAGAATGAAACACATCTTTAATCACTTAAGATTAATTTTCAATCAATGATTTAATCTTTTTTGTAAATAGTTTCGATATTTTGTCATTTGGATGGATATGAAATTATAGTATAAAGTGAATTTTATGTGGAGATTAGGCACAACGAGACCCGTCTCCTCTACATCGAGCAGCAATGGTGCTGATTAATTCACAAATGGACGATGGAGATTTCCCACAGCAGGTCTTCTCTCTCTTTCTCTCCATTGTCTCATGGAGATATATATATTAA ATGTATGTATATATATTCTCGAAAAACAAGGTATATACTGATCTTAAAGACGGCAAATCACATATAGTCAATACTTCTTGGGTGCTGTTGGCTCTCATTCAAACCGATCAGGCACAACGAGACCCGTCTCCTCTACATCGAGCAGCAATGGTGCTGATTAATTCACAAATGGACGATGGAGATTTCCCACAGCAGGTCTTCTCTCTCTTTCTCTCCATTGTCTCATGGAGATATATATATTAA ATGTATGTATATATATTCTCGAAAAACAAGGTATATACTGATCTTAAAGACGGCAAATCACATATAGTCAATACTTCTTGGGTGCTGTTGGCTCTCATTCAAACCGATCAGGCACAACGAGACCCGTCTCCTCTACATCGAGCAGCAATGGTGCTGATTAATTCACAAATGGACGATGGAGATTTCCCACAGCAGGTCTTCTCTCTCTTTCTCTCCATTGTCTCATGGAGATATATATATTAA MYVYIFSKNKVYTDLKDGKSHIVNTSWVLLALIQTDQAQRDPSPLHRAAMVLINSQMDDGDFPQQVFSLFLSIVSWRYIY*
BLAST of Csa1G025820 vs. Swiss-Prot
Match: OXSC_CUCPE (Probable oxidosqualene cyclase OS=Cucurbita pepo GN=CPR PE=2 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 3.6e-22 Identity = 49/62 (79.03%), Postives = 54/62 (87.10%), Query Frame = 1
BLAST of Csa1G025820 vs. Swiss-Prot
Match: CAS1_LUFAE (Cycloartenol synthase OS=Luffa aegyptiaca GN=CAS1 PE=1 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 3.7e-19 Identity = 44/83 (53.01%), Postives = 60/83 (72.29%), Query Frame = 1
BLAST of Csa1G025820 vs. Swiss-Prot
Match: CAS1_CUCPE (Cycloartenol synthase OS=Cucurbita pepo GN=CPX PE=1 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 1.4e-18 Identity = 40/62 (64.52%), Postives = 50/62 (80.65%), Query Frame = 1
BLAST of Csa1G025820 vs. Swiss-Prot
Match: LAS1_ARATH (Lanosterol synthase OS=Arabidopsis thaliana GN=LAS1 PE=2 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 2.4e-18 Identity = 43/62 (69.35%), Postives = 47/62 (75.81%), Query Frame = 1
BLAST of Csa1G025820 vs. Swiss-Prot
Match: CAS1_BETPL (Cycloartenol synthase OS=Betula platyphylla GN=CASBPX1 PE=1 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 2.4e-18 Identity = 40/62 (64.52%), Postives = 50/62 (80.65%), Query Frame = 1
BLAST of Csa1G025820 vs. TrEMBL
Match: A0A0A0LPS4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G025820 PE=4 SV=1) HSP 1 Score: 165.2 bits (417), Expect = 3.2e-38 Identity = 80/80 (100.00%), Postives = 80/80 (100.00%), Query Frame = 1
BLAST of Csa1G025820 vs. TrEMBL
Match: Q9SSU5_LUFAE (Terpene cyclase/mutase family member OS=Luffa aegyptiaca GN=LcOSC2 PE=2 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 3.1e-17 Identity = 52/83 (62.65%), Postives = 63/83 (75.90%), Query Frame = 1
BLAST of Csa1G025820 vs. TrEMBL
Match: A0A061GAT5_THECC (Terpene cyclase/mutase family member OS=Theobroma cacao GN=TCM_046828 PE=3 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 4.1e-17 Identity = 42/62 (67.74%), Postives = 53/62 (85.48%), Query Frame = 1
BLAST of Csa1G025820 vs. TrEMBL
Match: A0A0B0PN57_GOSAR (Terpene cyclase/mutase family member OS=Gossypium arboreum GN=F383_14998 PE=3 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 7.0e-17 Identity = 41/62 (66.13%), Postives = 53/62 (85.48%), Query Frame = 1
BLAST of Csa1G025820 vs. TrEMBL
Match: A0A0D2UKL7_GOSRA (Terpene cyclase/mutase family member OS=Gossypium raimondii GN=B456_009G120100 PE=3 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 7.0e-17 Identity = 41/62 (66.13%), Postives = 53/62 (85.48%), Query Frame = 1
BLAST of Csa1G025820 vs. TAIR10
Match: AT3G45130.1 (AT3G45130.1 lanosterol synthase 1) HSP 1 Score: 92.4 bits (228), Expect = 1.3e-19 Identity = 43/62 (69.35%), Postives = 47/62 (75.81%), Query Frame = 1
BLAST of Csa1G025820 vs. TAIR10
Match: AT2G07050.1 (AT2G07050.1 cycloartenol synthase 1) HSP 1 Score: 78.6 bits (192), Expect = 2.0e-15 Identity = 35/62 (56.45%), Postives = 46/62 (74.19%), Query Frame = 1
BLAST of Csa1G025820 vs. TAIR10
Match: AT1G78955.1 (AT1G78955.1 camelliol C synthase 1) HSP 1 Score: 73.2 bits (178), Expect = 8.4e-14 Identity = 32/62 (51.61%), Postives = 43/62 (69.35%), Query Frame = 1
BLAST of Csa1G025820 vs. TAIR10
Match: AT5G48010.2 (AT5G48010.2 thalianol synthase 1) HSP 1 Score: 72.8 bits (177), Expect = 1.1e-13 Identity = 33/62 (53.23%), Postives = 43/62 (69.35%), Query Frame = 1
BLAST of Csa1G025820 vs. TAIR10
Match: AT1G78500.1 (AT1G78500.1 Terpenoid cyclases family protein) HSP 1 Score: 72.0 bits (175), Expect = 1.9e-13 Identity = 33/62 (53.23%), Postives = 43/62 (69.35%), Query Frame = 1
BLAST of Csa1G025820 vs. NCBI nr
Match: gi|700208804|gb|KGN63900.1| (hypothetical protein Csa_1G025820 [Cucumis sativus]) HSP 1 Score: 165.2 bits (417), Expect = 4.6e-38 Identity = 80/80 (100.00%), Postives = 80/80 (100.00%), Query Frame = 1
BLAST of Csa1G025820 vs. NCBI nr
Match: gi|778656570|ref|XP_011649297.1| (PREDICTED: probable oxidosqualene cyclase [Cucumis sativus]) HSP 1 Score: 120.2 bits (300), Expect = 1.7e-24 Identity = 63/83 (75.90%), Postives = 70/83 (84.34%), Query Frame = 1
BLAST of Csa1G025820 vs. NCBI nr
Match: gi|659107098|ref|XP_008453521.1| (PREDICTED: probable oxidosqualene cyclase [Cucumis melo]) HSP 1 Score: 115.5 bits (288), Expect = 4.2e-23 Identity = 60/83 (72.29%), Postives = 68/83 (81.93%), Query Frame = 1
BLAST of Csa1G025820 vs. NCBI nr
Match: gi|75254647|sp|Q6BE23.1|OXSC_CUCPE (RecName: Full=Probable oxidosqualene cyclase) HSP 1 Score: 105.1 bits (261), Expect = 5.7e-20 Identity = 49/62 (79.03%), Postives = 56/62 (90.32%), Query Frame = 1
BLAST of Csa1G025820 vs. NCBI nr
Match: gi|6911851|emb|CAB72151.1| (oxidosqualene cyclase-like protein [Arabidopsis thaliana]) HSP 1 Score: 96.3 bits (238), Expect = 2.6e-17 Identity = 45/67 (67.16%), Postives = 52/67 (77.61%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|