Csa1G024970 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGGAGGTGATCAAGCAGATATGGCAGTTCACTCTCTTGGATCTAAACTTTCTTTAATTTCAGATCATGAACCTGAAAAATGTGGCAATAATAATGTCACCAATAATCACCAACAAAGACCTTGCTTTGATCCTTCTCTTGTTTCTCCTAAGGTCGTACCACCTATCTCGGTGGCTGCAGAGAGTGATCAAGCTCTTCGTCGGCCTCGAGGGCGACCTGCTGGGTCCAAAAACAAGCCTAAACCACCCATTATTGTTACCCGAGATAGCGCTAATGCACTACGAGCTCATGCCATTGAGGTTAGCACTGGGTGTGATGTCAACGAGAGCCTCTCCAACTTCGCTCGGAGGAAGCAGCGTGGCGTCTGCATTCTTAGCGGTAGCGGGTGTGTCACTAATGTTACGCTTCGCCAAGCTGCTTCCTCTGGTGCCATTGTCACTCTGCATGGCCGGTAA ATGGCTGGAGGTGATCAAGCAGATATGGCAGTTCACTCTCTTGGATCTAAACTTTCTTTAATTTCAGATCATGAACCTGAAAAATGTGGCAATAATAATGTCACCAATAATCACCAACAAAGACCTTGCTTTGATCCTTCTCTTGTTTCTCCTAAGGTCGTACCACCTATCTCGGTGGCTGCAGAGAGTGATCAAGCTCTTCGTCGGCCTCGAGGGCGACCTGCTGGGTCCAAAAACAAGCCTAAACCACCCATTATTGTTACCCGAGATAGCGCTAATGCACTACGAGCTCATGCCATTGAGGTTAGCACTGGGTGTGATGTCAACGAGAGCCTCTCCAACTTCGCTCGGAGGAAGCAGCGTGGCGTCTGCATTCTTAGCGGTAGCGGGTGTGTCACTAATGTTACGCTTCGCCAAGCTGCTTCCTCTGGTGCCATTGTCACTCTGCATGGCCGGTAA ATGGCTGGAGGTGATCAAGCAGATATGGCAGTTCACTCTCTTGGATCTAAACTTTCTTTAATTTCAGATCATGAACCTGAAAAATGTGGCAATAATAATGTCACCAATAATCACCAACAAAGACCTTGCTTTGATCCTTCTCTTGTTTCTCCTAAGGTCGTACCACCTATCTCGGTGGCTGCAGAGAGTGATCAAGCTCTTCGTCGGCCTCGAGGGCGACCTGCTGGGTCCAAAAACAAGCCTAAACCACCCATTATTGTTACCCGAGATAGCGCTAATGCACTACGAGCTCATGCCATTGAGGTTAGCACTGGGTGTGATGTCAACGAGAGCCTCTCCAACTTCGCTCGGAGGAAGCAGCGTGGCGTCTGCATTCTTAGCGGTAGCGGGTGTGTCACTAATGTTACGCTTCGCCAAGCTGCTTCCTCTGGTGCCATTGTCACTCTGCATGGCCGGTAA MAGGDQADMAVHSLGSKLSLISDHEPEKCGNNNVTNNHQQRPCFDPSLVSPKVVPPISVAAESDQALRRPRGRPAGSKNKPKPPIIVTRDSANALRAHAIEVSTGCDVNESLSNFARRKQRGVCILSGSGCVTNVTLRQAASSGAIVTLHGR*
BLAST of Csa1G024970 vs. Swiss-Prot
Match: AHL16_ARATH (AT-hook motif nuclear-localized protein 16 OS=Arabidopsis thaliana GN=AHL16 PE=1 SV=1) HSP 1 Score: 161.4 bits (407), Expect = 7.9e-39 Identity = 91/152 (59.87%), Postives = 110/152 (72.37%), Query Frame = 1
BLAST of Csa1G024970 vs. Swiss-Prot
Match: AHL21_ARATH (AT-hook motif nuclear-localized protein 21 OS=Arabidopsis thaliana GN=AHL21 PE=2 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 7.9e-31 Identity = 60/88 (68.18%), Postives = 74/88 (84.09%), Query Frame = 1
BLAST of Csa1G024970 vs. Swiss-Prot
Match: AHL24_ARATH (AT-hook motif nuclear-localized protein 24 OS=Arabidopsis thaliana GN=AHL24 PE=2 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 5.1e-30 Identity = 62/91 (68.13%), Postives = 74/91 (81.32%), Query Frame = 1
BLAST of Csa1G024970 vs. Swiss-Prot
Match: AHL22_ARATH (AT-hook motif nuclear-localized protein 22 OS=Arabidopsis thaliana GN=AHL22 PE=1 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 5.1e-30 Identity = 62/89 (69.66%), Postives = 74/89 (83.15%), Query Frame = 1
BLAST of Csa1G024970 vs. Swiss-Prot
Match: AHL26_ARATH (AT-hook motif nuclear-localized protein 26 OS=Arabidopsis thaliana GN=AHL26 PE=2 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 3.3e-29 Identity = 59/90 (65.56%), Postives = 73/90 (81.11%), Query Frame = 1
BLAST of Csa1G024970 vs. TrEMBL
Match: A0A0A0LPP3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G024970 PE=4 SV=1) HSP 1 Score: 307.4 bits (786), Expect = 9.9e-81 Identity = 152/152 (100.00%), Postives = 152/152 (100.00%), Query Frame = 1
BLAST of Csa1G024970 vs. TrEMBL
Match: B9SM86_RICCO (DNA binding protein, putative OS=Ricinus communis GN=RCOM_0297020 PE=4 SV=1) HSP 1 Score: 191.8 bits (486), Expect = 6.1e-46 Identity = 105/155 (67.74%), Postives = 124/155 (80.00%), Query Frame = 1
BLAST of Csa1G024970 vs. TrEMBL
Match: V4TKT7_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10032444mg PE=4 SV=1) HSP 1 Score: 187.6 bits (475), Expect = 1.1e-44 Identity = 102/153 (66.67%), Postives = 120/153 (78.43%), Query Frame = 1
BLAST of Csa1G024970 vs. TrEMBL
Match: A0A067F0S4_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g040216mg PE=4 SV=1) HSP 1 Score: 187.2 bits (474), Expect = 1.5e-44 Identity = 101/153 (66.01%), Postives = 120/153 (78.43%), Query Frame = 1
BLAST of Csa1G024970 vs. TrEMBL
Match: W9RSZ9_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_021386 PE=4 SV=1) HSP 1 Score: 184.9 bits (468), Expect = 7.4e-44 Identity = 101/155 (65.16%), Postives = 120/155 (77.42%), Query Frame = 1
BLAST of Csa1G024970 vs. TAIR10
Match: AT2G42940.1 (AT2G42940.1 Predicted AT-hook DNA-binding family protein) HSP 1 Score: 161.4 bits (407), Expect = 4.5e-40 Identity = 91/152 (59.87%), Postives = 110/152 (72.37%), Query Frame = 1
BLAST of Csa1G024970 vs. TAIR10
Match: AT2G35270.1 (AT2G35270.1 Predicted AT-hook DNA-binding family protein) HSP 1 Score: 134.8 bits (338), Expect = 4.5e-32 Identity = 60/88 (68.18%), Postives = 74/88 (84.09%), Query Frame = 1
BLAST of Csa1G024970 vs. TAIR10
Match: AT4G22810.1 (AT4G22810.1 Predicted AT-hook DNA-binding family protein) HSP 1 Score: 132.1 bits (331), Expect = 2.9e-31 Identity = 62/91 (68.13%), Postives = 74/91 (81.32%), Query Frame = 1
BLAST of Csa1G024970 vs. TAIR10
Match: AT2G45430.1 (AT2G45430.1 AT-hook motif nuclear-localized protein 22) HSP 1 Score: 132.1 bits (331), Expect = 2.9e-31 Identity = 62/89 (69.66%), Postives = 74/89 (83.15%), Query Frame = 1
BLAST of Csa1G024970 vs. TAIR10
Match: AT4G12050.1 (AT4G12050.1 Predicted AT-hook DNA-binding family protein) HSP 1 Score: 129.4 bits (324), Expect = 1.9e-30 Identity = 59/90 (65.56%), Postives = 73/90 (81.11%), Query Frame = 1
BLAST of Csa1G024970 vs. NCBI nr
Match: gi|778656460|ref|XP_011649113.1| (PREDICTED: AT-hook motif nuclear-localized protein 16 [Cucumis sativus]) HSP 1 Score: 307.4 bits (786), Expect = 1.4e-80 Identity = 152/152 (100.00%), Postives = 152/152 (100.00%), Query Frame = 1
BLAST of Csa1G024970 vs. NCBI nr
Match: gi|700208769|gb|KGN63865.1| (hypothetical protein Csa_1G024970 [Cucumis sativus]) HSP 1 Score: 307.4 bits (786), Expect = 1.4e-80 Identity = 152/152 (100.00%), Postives = 152/152 (100.00%), Query Frame = 1
BLAST of Csa1G024970 vs. NCBI nr
Match: gi|659106919|ref|XP_008453469.1| (PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]) HSP 1 Score: 299.7 bits (766), Expect = 3.0e-78 Identity = 150/153 (98.04%), Postives = 152/153 (99.35%), Query Frame = 1
BLAST of Csa1G024970 vs. NCBI nr
Match: gi|645246667|ref|XP_008229461.1| (PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]) HSP 1 Score: 192.6 bits (488), Expect = 5.1e-46 Identity = 105/155 (67.74%), Postives = 123/155 (79.35%), Query Frame = 1
BLAST of Csa1G024970 vs. NCBI nr
Match: gi|255572333|ref|XP_002527105.1| (PREDICTED: AT-hook motif nuclear-localized protein 16 [Ricinus communis]) HSP 1 Score: 191.8 bits (486), Expect = 8.7e-46 Identity = 105/155 (67.74%), Postives = 124/155 (80.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |