Csa1G014510 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.CATTTTTTAAGAACAAAGCAAGGGAGAGATGACAGTTGTATGGAAAGAGTTCTTGCAATGGAACTCTCCCATCCCATATATCTTTGGAGGCCTTGCTGTTGTTTTCGGAATCACTTCTGCCGTTCTTTTTATCCTTGCTTGCTCTCACCAAATATGGATGCGAAATTCTATCAACAACGACAAAGAGAAAGCAAGCAAAAACAAAGGAAGCGAGCAATTTGATACTACTCCAAGTATAGCTGTAATCATGGCTGGAGATGATCATCCCAAGTACATGGCAAAGCCTGTCTCTTTTGTTAAGAATTAG ATGACAGTTGTATGGAAAGAGTTCTTGCAATGGAACTCTCCCATCCCATATATCTTTGGAGGCCTTGCTGTTGTTTTCGGAATCACTTCTGCCGTTCTTTTTATCCTTGCTTGCTCTCACCAAATATGGATGCGAAATTCTATCAACAACGACAAAGAGAAAGCAAGCAAAAACAAAGGAAGCGAGCAATTTGATACTACTCCAAGTATAGCTGTAATCATGGCTGGAGATGATCATCCCAAGTACATGGCAAAGCCTGTCTCTTTTGTTAAGAATTAG ATGACAGTTGTATGGAAAGAGTTCTTGCAATGGAACTCTCCCATCCCATATATCTTTGGAGGCCTTGCTGTTGTTTTCGGAATCACTTCTGCCGTTCTTTTTATCCTTGCTTGCTCTCACCAAATATGGATGCGAAATTCTATCAACAACGACAAAGAGAAAGCAAGCAAAAACAAAGGAAGCGAGCAATTTGATACTACTCCAAGTATAGCTGTAATCATGGCTGGAGATGATCATCCCAAGTACATGGCAAAGCCTGTCTCTTTTGTTAAGAATTAG MTVVWKEFLQWNSPIPYIFGGLAVVFGITSAVLFILACSHQIWMRNSINNDKEKASKNKGSEQFDTTPSIAVIMAGDDHPKYMAKPVSFVKN*
BLAST of Csa1G014510 vs. Swiss-Prot
Match: GDU4_ARATH (Protein GLUTAMINE DUMPER 4 OS=Arabidopsis thaliana GN=GDU4 PE=2 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 3.0e-09 Identity = 34/85 (40.00%), Postives = 48/85 (56.47%), Query Frame = 1
BLAST of Csa1G014510 vs. Swiss-Prot
Match: GDU1_ARATH (Protein GLUTAMINE DUMPER 1 OS=Arabidopsis thaliana GN=GDU1 PE=1 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 4.0e-09 Identity = 34/83 (40.96%), Postives = 47/83 (56.63%), Query Frame = 1
BLAST of Csa1G014510 vs. Swiss-Prot
Match: GDU5_ARATH (Protein GLUTAMINE DUMPER 5 OS=Arabidopsis thaliana GN=GDU5 PE=2 SV=2) HSP 1 Score: 60.1 bits (144), Expect = 1.5e-08 Identity = 30/79 (37.97%), Postives = 49/79 (62.03%), Query Frame = 1
BLAST of Csa1G014510 vs. Swiss-Prot
Match: GDU3_ARATH (Protein GLUTAMINE DUMPER 3 OS=Arabidopsis thaliana GN=GDU3 PE=2 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 3.4e-08 Identity = 32/88 (36.36%), Postives = 44/88 (50.00%), Query Frame = 1
BLAST of Csa1G014510 vs. Swiss-Prot
Match: GDU2_ARATH (Protein GLUTAMINE DUMPER 2 OS=Arabidopsis thaliana GN=GDU2 PE=2 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 2.2e-07 Identity = 32/85 (37.65%), Postives = 40/85 (47.06%), Query Frame = 1
BLAST of Csa1G014510 vs. TrEMBL
Match: A0A0A0LRW3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G014510 PE=4 SV=1) HSP 1 Score: 192.6 bits (488), Expect = 2.2e-46 Identity = 92/92 (100.00%), Postives = 92/92 (100.00%), Query Frame = 1
BLAST of Csa1G014510 vs. TrEMBL
Match: A0A0D2NZ67_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_003G104400 PE=4 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 8.3e-14 Identity = 43/87 (49.43%), Postives = 53/87 (60.92%), Query Frame = 1
BLAST of Csa1G014510 vs. TrEMBL
Match: A0A061ENI6_THECC (Glutamine dumper 2, putative OS=Theobroma cacao GN=TCM_019105 PE=4 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 1.9e-13 Identity = 39/81 (48.15%), Postives = 55/81 (67.90%), Query Frame = 1
BLAST of Csa1G014510 vs. TrEMBL
Match: A0A067F5V9_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g035876mg PE=4 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 6.0e-12 Identity = 38/82 (46.34%), Postives = 51/82 (62.20%), Query Frame = 1
BLAST of Csa1G014510 vs. TrEMBL
Match: B9SXU4_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0877440 PE=4 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 2.3e-11 Identity = 39/82 (47.56%), Postives = 53/82 (64.63%), Query Frame = 1
BLAST of Csa1G014510 vs. TAIR10
Match: AT2G24762.1 (AT2G24762.1 glutamine dumper 4) HSP 1 Score: 62.4 bits (150), Expect = 1.7e-10 Identity = 34/85 (40.00%), Postives = 48/85 (56.47%), Query Frame = 1
BLAST of Csa1G014510 vs. TAIR10
Match: AT4G31730.1 (AT4G31730.1 glutamine dumper 1) HSP 1 Score: 62.0 bits (149), Expect = 2.2e-10 Identity = 34/83 (40.96%), Postives = 47/83 (56.63%), Query Frame = 1
BLAST of Csa1G014510 vs. TAIR10
Match: AT5G24920.1 (AT5G24920.1 glutamine dumper 5) HSP 1 Score: 60.1 bits (144), Expect = 8.5e-10 Identity = 30/79 (37.97%), Postives = 49/79 (62.03%), Query Frame = 1
BLAST of Csa1G014510 vs. TAIR10
Match: AT5G57685.1 (AT5G57685.1 glutamine dumper 3) HSP 1 Score: 58.9 bits (141), Expect = 1.9e-09 Identity = 32/88 (36.36%), Postives = 44/88 (50.00%), Query Frame = 1
BLAST of Csa1G014510 vs. TAIR10
Match: AT4G25760.1 (AT4G25760.1 glutamine dumper 2) HSP 1 Score: 56.2 bits (134), Expect = 1.2e-08 Identity = 32/85 (37.65%), Postives = 40/85 (47.06%), Query Frame = 1
BLAST of Csa1G014510 vs. NCBI nr
Match: gi|700208658|gb|KGN63754.1| (hypothetical protein Csa_1G014510 [Cucumis sativus]) HSP 1 Score: 192.6 bits (488), Expect = 3.1e-46 Identity = 92/92 (100.00%), Postives = 92/92 (100.00%), Query Frame = 1
BLAST of Csa1G014510 vs. NCBI nr
Match: gi|763752065|gb|KJB19453.1| (hypothetical protein B456_003G104400 [Gossypium raimondii]) HSP 1 Score: 84.3 bits (207), Expect = 1.2e-13 Identity = 43/87 (49.43%), Postives = 53/87 (60.92%), Query Frame = 1
BLAST of Csa1G014510 vs. NCBI nr
Match: gi|590651722|ref|XP_007032963.1| (Glutamine dumper 2, putative [Theobroma cacao]) HSP 1 Score: 83.2 bits (204), Expect = 2.7e-13 Identity = 39/81 (48.15%), Postives = 55/81 (67.90%), Query Frame = 1
BLAST of Csa1G014510 vs. NCBI nr
Match: gi|731418186|ref|XP_010660581.1| (PREDICTED: protein GLUTAMINE DUMPER 3-like [Vitis vinifera]) HSP 1 Score: 79.0 bits (193), Expect = 5.0e-12 Identity = 39/81 (48.15%), Postives = 54/81 (66.67%), Query Frame = 1
BLAST of Csa1G014510 vs. NCBI nr
Match: gi|985454098|ref|XP_015386993.1| (PREDICTED: protein GLUTAMINE DUMPER 6 [Citrus sinensis]) HSP 1 Score: 78.2 bits (191), Expect = 8.5e-12 Identity = 38/82 (46.34%), Postives = 51/82 (62.20%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |