CsGy6G031360 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATCGCCCCAATTGGAGTTTTAAACTGCTTTTCATTTTGTTAGAGACATTGTTATTGATAGTCACCACCACAGTTAGCCAACCACAGTTTTTCCATCACAATTGTTCCAACGTAGGCAACTACACCAACACCAGTCCATTCAAGAAAAATCTAGACACTGTTCTTGCATCCATCTCCACCAATTCCCAGGTCGACAAAGGTTTCTATGCCATCGAAGGAGAAGAACCAAACTGA ATGGATCGCCCCAATTGGAGTTTTAAACTGCTTTTCATTTTGTTAGAGACATTGTTATTGATAGTCACCACCACAGTTAGCCAACCACAGTTTTTCCATCACAATTGTTCCAACGTAGGCAACTACACCAACACCAGTCCATTCAAGAAAAATCTAGACACTGTTCTTGCATCCATCTCCACCAATTCCCAGGTCGACAAAGGTTTCTATGCCATCGAAGGAGAAGAACCAAACTGA ATGGATCGCCCCAATTGGAGTTTTAAACTGCTTTTCATTTTGTTAGAGACATTGTTATTGATAGTCACCACCACAGTTAGCCAACCACAGTTTTTCCATCACAATTGTTCCAACGTAGGCAACTACACCAACACCAGTCCATTCAAGAAAAATCTAGACACTGTTCTTGCATCCATCTCCACCAATTCCCAGGTCGACAAAGGTTTCTATGCCATCGAAGGAGAAGAACCAAACTGA MDRPNWSFKLLFILLETLLLIVTTTVSQPQFFHHNCSNVGNYTNTSPFKKNLDTVLASISTNSQVDKGFYAIEGEEPN
BLAST of CsGy6G031360 vs. NCBI nr
Match: XP_008441128.1 (PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis melo]) HSP 1 Score: 105.1 bits (261), Expect = 1.1e-19 Identity = 63/79 (79.75%), Postives = 65/79 (82.28%), Query Frame = 0
BLAST of CsGy6G031360 vs. NCBI nr
Match: XP_022977358.1 (putative receptor-like protein kinase At4g00960 isoform X2 [Cucurbita maxima]) HSP 1 Score: 61.2 bits (147), Expect = 1.8e-06 Identity = 30/46 (65.22%), Postives = 36/46 (78.26%), Query Frame = 0
BLAST of CsGy6G031360 vs. NCBI nr
Match: XP_022977356.1 (putative receptor-like protein kinase At4g00960 isoform X1 [Cucurbita maxima]) HSP 1 Score: 61.2 bits (147), Expect = 1.8e-06 Identity = 30/46 (65.22%), Postives = 36/46 (78.26%), Query Frame = 0
BLAST of CsGy6G031360 vs. NCBI nr
Match: KGN49150.1 (hypothetical protein Csa_6G516580 [Cucumis sativus]) HSP 1 Score: 60.5 bits (145), Expect = 3.0e-06 Identity = 33/52 (63.46%), Postives = 38/52 (73.08%), Query Frame = 0
BLAST of CsGy6G031360 vs. NCBI nr
Match: XP_004134966.2 (PREDICTED: cysteine-rich receptor-like protein kinase 10 [Cucumis sativus]) HSP 1 Score: 60.5 bits (145), Expect = 3.0e-06 Identity = 33/52 (63.46%), Postives = 38/52 (73.08%), Query Frame = 0
BLAST of CsGy6G031360 vs. TAIR10
Match: AT3G21990.1 (Domain of unknown function (DUF26)) HSP 1 Score: 42.7 bits (99), Expect = 1.2e-04 Identity = 23/48 (47.92%), Postives = 30/48 (62.50%), Query Frame = 0
BLAST of CsGy6G031360 vs. TAIR10
Match: AT4G20670.1 (Domain of unknown function (DUF26)) HSP 1 Score: 42.7 bits (99), Expect = 1.2e-04 Identity = 23/48 (47.92%), Postives = 30/48 (62.50%), Query Frame = 0
BLAST of CsGy6G031360 vs. TAIR10
Match: AT4G20650.1 (receptor-like protein kinase-related) HSP 1 Score: 42.7 bits (99), Expect = 1.2e-04 Identity = 23/48 (47.92%), Postives = 30/48 (62.50%), Query Frame = 0
BLAST of CsGy6G031360 vs. TAIR10
Match: AT4G20640.1 (Protein with domains of unknown function (DUF26 and DUF1204)) HSP 1 Score: 42.7 bits (99), Expect = 1.2e-04 Identity = 23/48 (47.92%), Postives = 30/48 (62.50%), Query Frame = 0
BLAST of CsGy6G031360 vs. TAIR10
Match: AT4G20620.1 (Protein with domains of unknown function (DUF26 and DUF1204)) HSP 1 Score: 42.7 bits (99), Expect = 1.2e-04 Identity = 23/48 (47.92%), Postives = 30/48 (62.50%), Query Frame = 0
BLAST of CsGy6G031360 vs. TrEMBL
Match: tr|A0A1S3B2Q9|A0A1S3B2Q9_CUCME (cysteine-rich repeat secretory protein 38-like OS=Cucumis melo OX=3656 GN=LOC103485358 PE=4 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 7.0e-20 Identity = 63/79 (79.75%), Postives = 65/79 (82.28%), Query Frame = 0
BLAST of CsGy6G031360 vs. TrEMBL
Match: tr|A0A0A0KHG1|A0A0A0KHG1_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G516580 PE=4 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 2.0e-06 Identity = 33/52 (63.46%), Postives = 38/52 (73.08%), Query Frame = 0
BLAST of CsGy6G031360 vs. TrEMBL
Match: tr|A0A1S3AZK3|A0A1S3AZK3_CUCME (uncharacterized protein LOC103484586 OS=Cucumis melo OX=3656 GN=LOC103484586 PE=4 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 4.4e-06 Identity = 32/52 (61.54%), Postives = 37/52 (71.15%), Query Frame = 0
BLAST of CsGy6G031360 vs. TrEMBL
Match: tr|A0A0A0KL98|A0A0A0KL98_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G516500 PE=4 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 3.8e-05 Identity = 27/44 (61.36%), Postives = 32/44 (72.73%), Query Frame = 0
BLAST of CsGy6G031360 vs. TrEMBL
Match: tr|A0A0A0KHF3|A0A0A0KHF3_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G515490 PE=4 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 8.4e-05 Identity = 23/46 (50.00%), Postives = 36/46 (78.26%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |