CsGy6G025700 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTCCTGAACCAATTGTTGGAGATTATCGACCATGTGAGAATTCAGATGGTGAACATGCGAAAGAAGTAGCACAATGGGCAGTAACAGAATACAACATAAAACACCGCCATGAACGTCCTTACTTGTACCTTCTTAGTGTATTGAAGTGCGAGTCGCAAGTGGTGGCTGGAACCAATTGGCGTCTGGGGTTGAAGTGTAAGGATGAAAATAATATTGAGGTAAAGTGTGAGGCTGTTGTGTGGGAGAAGAGATGGGAGAATTTCTTGGAGCTCACATCCTTCGTAGTATTCTACCCATCTTCTGGCTGA ATGTCTCCTGAACCAATTGTTGGAGATTATCGACCATGTGAGAATTCAGATGGTGAACATGCGAAAGAAGTAGCACAATGGGCAGTAACAGAATACAACATAAAACACCGCCATGAACGTCCTTACTTGTACCTTCTTAGTGTATTGAAGTGCGAGTCGCAAGTGGTGGCTGGAACCAATTGGCGTCTGGGGTTGAAGTGTAAGGATGAAAATAATATTGAGGTAAAGTGTGAGGCTGTTGTGTGGGAGAAGAGATGGGAGAATTTCTTGGAGCTCACATCCTTCGTAGTATTCTACCCATCTTCTGGCTGA ATGTCTCCTGAACCAATTGTTGGAGATTATCGACCATGTGAGAATTCAGATGGTGAACATGCGAAAGAAGTAGCACAATGGGCAGTAACAGAATACAACATAAAACACCGCCATGAACGTCCTTACTTGTACCTTCTTAGTGTATTGAAGTGCGAGTCGCAAGTGGTGGCTGGAACCAATTGGCGTCTGGGGTTGAAGTGTAAGGATGAAAATAATATTGAGGTAAAGTGTGAGGCTGTTGTGTGGGAGAAGAGATGGGAGAATTTCTTGGAGCTCACATCCTTCGTAGTATTCTACCCATCTTCTGGCTGA MSPEPIVGDYRPCENSDGEHAKEVAQWAVTEYNIKHRHERPYLYLLSVLKCESQVVAGTNWRLGLKCKDENNIEVKCEAVVWEKRWENFLELTSFVVFYPSSG
BLAST of CsGy6G025700 vs. NCBI nr
Match: KGN48305.1 (hypothetical protein Csa_6G460000 [Cucumis sativus]) HSP 1 Score: 208.4 bits (529), Expect = 1.2e-50 Identity = 96/103 (93.20%), Postives = 97/103 (94.17%), Query Frame = 0
BLAST of CsGy6G025700 vs. NCBI nr
Match: KGN48304.1 (hypothetical protein Csa_6G459990 [Cucumis sativus]) HSP 1 Score: 203.4 bits (516), Expect = 3.8e-49 Identity = 93/103 (90.29%), Postives = 95/103 (92.23%), Query Frame = 0
BLAST of CsGy6G025700 vs. NCBI nr
Match: NP_001267677.1 (cysteine proteinase inhibitor 5-like [Cucumis sativus] >BAA28867.1 cystein proteinase inhibitor [Cucumis sativus]) HSP 1 Score: 113.2 bits (282), Expect = 5.2e-22 Identity = 52/89 (58.43%), Postives = 64/89 (71.91%), Query Frame = 0
BLAST of CsGy6G025700 vs. NCBI nr
Match: XP_008441065.1 (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis melo]) HSP 1 Score: 89.7 bits (221), Expect = 6.1e-15 Identity = 44/93 (47.31%), Postives = 56/93 (60.22%), Query Frame = 0
BLAST of CsGy6G025700 vs. NCBI nr
Match: XP_009396391.1 (PREDICTED: cysteine proteinase inhibitor 1-like [Musa acuminata subsp. malaccensis]) HSP 1 Score: 89.4 bits (220), Expect = 8.0e-15 Identity = 45/94 (47.87%), Postives = 62/94 (65.96%), Query Frame = 0
BLAST of CsGy6G025700 vs. TAIR10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 62.0 bits (149), Expect = 2.5e-10 Identity = 32/89 (35.96%), Postives = 48/89 (53.93%), Query Frame = 0
BLAST of CsGy6G025700 vs. TAIR10
Match: AT5G05110.1 (Cystatin/monellin family protein) HSP 1 Score: 51.6 bits (122), Expect = 3.3e-07 Identity = 33/84 (39.29%), Postives = 44/84 (52.38%), Query Frame = 0
BLAST of CsGy6G025700 vs. TAIR10
Match: AT2G40880.1 (cystatin A) HSP 1 Score: 48.5 bits (114), Expect = 2.8e-06 Identity = 32/89 (35.96%), Postives = 49/89 (55.06%), Query Frame = 0
BLAST of CsGy6G025700 vs. TAIR10
Match: AT3G12490.2 (cystatin B) HSP 1 Score: 48.1 bits (113), Expect = 3.7e-06 Identity = 35/89 (39.33%), Postives = 47/89 (52.81%), Query Frame = 0
BLAST of CsGy6G025700 vs. TAIR10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 45.8 bits (107), Expect = 1.8e-05 Identity = 28/89 (31.46%), Postives = 45/89 (50.56%), Query Frame = 0
BLAST of CsGy6G025700 vs. Swiss-Prot
Match: sp|Q6TPK4|CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.4e-10 Identity = 38/88 (43.18%), Postives = 55/88 (62.50%), Query Frame = 0
BLAST of CsGy6G025700 vs. Swiss-Prot
Match: sp|Q41916|CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 62.0 bits (149), Expect = 4.5e-09 Identity = 32/89 (35.96%), Postives = 48/89 (53.93%), Query Frame = 0
BLAST of CsGy6G025700 vs. Swiss-Prot
Match: sp|P09229|CYT1_ORYSJ (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 56.2 bits (134), Expect = 2.4e-07 Identity = 34/91 (37.36%), Postives = 51/91 (56.04%), Query Frame = 0
BLAST of CsGy6G025700 vs. Swiss-Prot
Match: sp|P31726|CYT1_MAIZE (Cystatin-1 OS=Zea mays OX=4577 GN=RAMDAZC7 PE=2 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 2.1e-06 Identity = 31/81 (38.27%), Postives = 47/81 (58.02%), Query Frame = 0
BLAST of CsGy6G025700 vs. Swiss-Prot
Match: sp|Q8LC76|CYT7_ARATH (Cysteine proteinase inhibitor 7 OS=Arabidopsis thaliana OX=3702 GN=CYS7 PE=2 SV=2) HSP 1 Score: 51.6 bits (122), Expect = 6.0e-06 Identity = 33/84 (39.29%), Postives = 44/84 (52.38%), Query Frame = 0
BLAST of CsGy6G025700 vs. TrEMBL
Match: tr|A0A0A0KF17|A0A0A0KF17_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 GN=Csa_6G460000 PE=3 SV=1) HSP 1 Score: 208.4 bits (529), Expect = 7.8e-51 Identity = 96/103 (93.20%), Postives = 97/103 (94.17%), Query Frame = 0
BLAST of CsGy6G025700 vs. TrEMBL
Match: tr|A0A0A0KHK7|A0A0A0KHK7_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 GN=Csa_6G459990 PE=3 SV=1) HSP 1 Score: 203.4 bits (516), Expect = 2.5e-49 Identity = 93/103 (90.29%), Postives = 95/103 (92.23%), Query Frame = 0
BLAST of CsGy6G025700 vs. TrEMBL
Match: tr|O80389|O80389_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 PE=2 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 3.4e-22 Identity = 52/89 (58.43%), Postives = 64/89 (71.91%), Query Frame = 0
BLAST of CsGy6G025700 vs. TrEMBL
Match: tr|A0A1S3B2L7|A0A1S3B2L7_CUCME (Cysteine proteinase inhibitor OS=Cucumis melo OX=3656 GN=LOC103485290 PE=3 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 4.0e-15 Identity = 44/93 (47.31%), Postives = 56/93 (60.22%), Query Frame = 0
BLAST of CsGy6G025700 vs. TrEMBL
Match: tr|M0SNR0|M0SNR0_MUSAM (Cysteine proteinase inhibitor OS=Musa acuminata subsp. malaccensis OX=214687 GN=103981394 PE=3 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 5.3e-15 Identity = 45/94 (47.87%), Postives = 62/94 (65.96%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|