CsGy5G028780 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTCGACCATCAAGTTCCATTCTCGGTCCTTTACATTGCATTTTGAAGCTTCACAGTTCTAGACAAAACTCAATTCCAGTAAGACATTGTTACAGGCAAACCATTTCTCTGGGTTGTTAGGCAATACATTACTGAAGAAAACCCTAACAATGCCTTCCCATTAGGGTTTCAAGATTGTGTATTCGGCTCCTCAACAAAGGGTTCTTAATCATCCATCAATTGCTTGCTTTGTGAGCCACTGTGGCTGGAATTCGACGCTTGAAAGTCTCAGCATGGTGTTCGGTTCCTGTGTTGGCCATACTTTGGCAACCAGTTTCTTGTTGAGAGCTACATTTGTGATATATGGAATGTGGGGTTGA ATGGCTCGACCATCAAGTTCCATTCTCGGTCCTTTACATTGCATTTTGAAGCTTCACAGTTCTAGACAAAACTCAATTCCAGGTTTCAAGATTGTGTATTCGGCTCCTCAACAAAGGGTTCTTAATCATCCATCAATTGCTTGCTTTGTGAGCCACTGTGGCTGGAATTCGACGCTTGAAAGTCTCAGCATGGTGTTCGGTTCCTGTGTTGGCCATACTTTGGCAACCAGTTTCTTGTTGAGAGCTACATTTGTGATATATGGAATGTGGGGTTGA ATGGCTCGACCATCAAGTTCCATTCTCGGTCCTTTACATTGCATTTTGAAGCTTCACAGTTCTAGACAAAACTCAATTCCAGGTTTCAAGATTGTGTATTCGGCTCCTCAACAAAGGGTTCTTAATCATCCATCAATTGCTTGCTTTGTGAGCCACTGTGGCTGGAATTCGACGCTTGAAAGTCTCAGCATGGTGTTCGGTTCCTGTGTTGGCCATACTTTGGCAACCAGTTTCTTGTTGAGAGCTACATTTGTGATATATGGAATGTGGGGTTGA MARPSSSILGPLHCILKLHSSRQNSIPGFKIVYSAPQQRVLNHPSIACFVSHCGWNSTLESLSMVFGSCVGHTLATSFLLRATFVIYGMWG
BLAST of CsGy5G028780 vs. NCBI nr
Match: XP_006573253.1 (UDP-glycosyltransferase 83A1 [Glycine max]) HSP 1 Score: 71.2 bits (173), Expect = 2.0e-09 Identity = 32/57 (56.14%), Postives = 42/57 (73.68%), Query Frame = 0
BLAST of CsGy5G028780 vs. NCBI nr
Match: XP_008459382.1 (PREDICTED: UDP-glycosyltransferase 83A1 [Cucumis melo]) HSP 1 Score: 68.9 bits (167), Expect = 9.9e-09 Identity = 32/34 (94.12%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of CsGy5G028780 vs. NCBI nr
Match: XP_022938984.1 (UDP-glycosyltransferase 83A1-like [Cucurbita moschata]) HSP 1 Score: 67.8 bits (164), Expect = 2.2e-08 Identity = 31/34 (91.18%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of CsGy5G028780 vs. NCBI nr
Match: XP_022993600.1 (UDP-glycosyltransferase 83A1 [Cucurbita maxima]) HSP 1 Score: 67.8 bits (164), Expect = 2.2e-08 Identity = 31/34 (91.18%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of CsGy5G028780 vs. NCBI nr
Match: XP_023549624.1 (UDP-glycosyltransferase 83A1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 67.8 bits (164), Expect = 2.2e-08 Identity = 31/34 (91.18%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of CsGy5G028780 vs. TAIR10
Match: AT4G15480.1 (UDP-Glycosyltransferase superfamily protein) HSP 1 Score: 58.5 bits (140), Expect = 2.4e-09 Identity = 24/33 (72.73%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of CsGy5G028780 vs. TAIR10
Match: AT4G15490.1 (UDP-Glycosyltransferase superfamily protein) HSP 1 Score: 58.2 bits (139), Expect = 3.2e-09 Identity = 24/34 (70.59%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of CsGy5G028780 vs. TAIR10
Match: AT3G21560.1 (UDP-Glycosyltransferase superfamily protein) HSP 1 Score: 55.8 bits (133), Expect = 1.6e-08 Identity = 22/34 (64.71%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of CsGy5G028780 vs. TAIR10
Match: AT4G15500.1 (UDP-Glycosyltransferase superfamily protein) HSP 1 Score: 53.5 bits (127), Expect = 7.8e-08 Identity = 21/34 (61.76%), Postives = 29/34 (85.29%), Query Frame = 0
BLAST of CsGy5G028780 vs. TAIR10
Match: AT1G05675.1 (UDP-Glycosyltransferase superfamily protein) HSP 1 Score: 51.6 bits (122), Expect = 3.0e-07 Identity = 21/30 (70.00%), Postives = 24/30 (80.00%), Query Frame = 0
BLAST of CsGy5G028780 vs. Swiss-Prot
Match: sp|Q9MB73|LGT_CITUN (Limonoid UDP-glucosyltransferase OS=Citrus unshiu OX=55188 PE=2 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 2.6e-08 Identity = 23/34 (67.65%), Postives = 31/34 (91.18%), Query Frame = 0
BLAST of CsGy5G028780 vs. Swiss-Prot
Match: sp|Q5XF20|U84A1_ARATH (UDP-glycosyltransferase 84A1 OS=Arabidopsis thaliana OX=3702 GN=UGT84A1 PE=1 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 4.4e-08 Identity = 24/33 (72.73%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of CsGy5G028780 vs. Swiss-Prot
Match: sp|Q66PF4|CGT_FRAAN (Cinnamate beta-D-glucosyltransferase OS=Fragaria ananassa OX=3747 GN=GT2 PE=1 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 5.7e-08 Identity = 22/34 (64.71%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of CsGy5G028780 vs. Swiss-Prot
Match: sp|O23401|U84A3_ARATH (UDP-glycosyltransferase 84A3 OS=Arabidopsis thaliana OX=3702 GN=UGT84A3 PE=1 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 5.7e-08 Identity = 24/34 (70.59%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of CsGy5G028780 vs. Swiss-Prot
Match: sp|V5LLZ9|GGT_QUERO (Gallate 1-beta-glucosyltransferase OS=Quercus robur OX=38942 GN=UGT84A13 PE=1 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 7.4e-08 Identity = 22/34 (64.71%), Postives = 31/34 (91.18%), Query Frame = 0
BLAST of CsGy5G028780 vs. TrEMBL
Match: tr|A0A1S3CB98|A0A1S3CB98_CUCME (UDP-glycosyltransferase 83A1 OS=Cucumis melo OX=3656 GN=LOC103498530 PE=4 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 6.5e-09 Identity = 32/34 (94.12%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of CsGy5G028780 vs. TrEMBL
Match: tr|A0A2P5ED73|A0A2P5ED73_9ROSA (UDP-glucuronosyl/UDP-glucosyltransferase OS=Trema orientalis OX=63057 GN=TorRG33x02_207540 PE=4 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 2.5e-08 Identity = 31/47 (65.96%), Postives = 38/47 (80.85%), Query Frame = 0
BLAST of CsGy5G028780 vs. TrEMBL
Match: tr|A0A0A0KXK4|A0A0A0KXK4_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G638455 PE=4 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 3.2e-08 Identity = 31/34 (91.18%), Postives = 31/34 (91.18%), Query Frame = 0
BLAST of CsGy5G028780 vs. TrEMBL
Match: tr|A0A0A0KUF9|A0A0A0KUF9_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G638465 PE=4 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 3.2e-08 Identity = 31/34 (91.18%), Postives = 31/34 (91.18%), Query Frame = 0
BLAST of CsGy5G028780 vs. TrEMBL
Match: tr|A0A2P5A5Q9|A0A2P5A5Q9_PARAD (UDP-glucuronosyl/UDP-glucosyltransferase OS=Parasponia andersonii OX=3476 GN=PanWU01x14_366040 PE=4 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 4.2e-08 Identity = 31/47 (65.96%), Postives = 37/47 (78.72%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |