CsGy4G000300 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGTGGAAAAAAGTTGCTTTAGTTGCAATGATGGGGATGTTGCTTATGGCTACTTTTACAGAGTCAGTCGGTTTGGGCGTGGATGAGGAGATCATTCAATTAGTTTCGGACGGGCTGAATGAGTACTCACAAAATATTGGAAAGGAAACTGTAGGCTGCCCTCGAATCCTTATGCCGTGTAAATCCGACCACGACTGCTTAAGTGGCTGCACTTGCAAACGAAACGGCTATTGTGGTTGA ATGGAGTGGAAAAAAGTTGCTTTAGTTGCAATGATGGGGATGTTGCTTATGGCTACTTTTACAGAGTCAGTCGGTTTGGGCGTGGATGAGGAGATCATTCAATTAGTTTCGGACGGGCTGAATGAGTACTCACAAAATATTGGAAAGGAAACTGTAGGCTGCCCTCGAATCCTTATGCCGTGTAAATCCGACCACGACTGCTTAAGTGGCTGCACTTGCAAACGAAACGGCTATTGTGGTTGA ATGGAGTGGAAAAAAGTTGCTTTAGTTGCAATGATGGGGATGTTGCTTATGGCTACTTTTACAGAGTCAGTCGGTTTGGGCGTGGATGAGGAGATCATTCAATTAGTTTCGGACGGGCTGAATGAGTACTCACAAAATATTGGAAAGGAAACTGTAGGCTGCCCTCGAATCCTTATGCCGTGTAAATCCGACCACGACTGCTTAAGTGGCTGCACTTGCAAACGAAACGGCTATTGTGGTTGA MEWKKVALVAMMGMLLMATFTESVGLGVDEEIIQLVSDGLNEYSQNIGKETVGCPRILMPCKSDHDCLSGCTCKRNGYCG
BLAST of CsGy4G000300 vs. NCBI nr
Match: KGN52761.1 (Trypsin inhibitor 1 [Cucumis sativus]) HSP 1 Score: 142.9 bits (359), Expect = 4.7e-31 Identity = 69/81 (85.19%), Postives = 73/81 (90.12%), Query Frame = 0
BLAST of CsGy4G000300 vs. NCBI nr
Match: XP_023552845.1 (uncharacterized protein LOC111810370 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 95.9 bits (237), Expect = 6.6e-17 Identity = 43/80 (53.75%), Postives = 59/80 (73.75%), Query Frame = 0
BLAST of CsGy4G000300 vs. NCBI nr
Match: XP_022984819.1 (trypsin inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 95.1 bits (235), Expect = 1.1e-16 Identity = 44/80 (55.00%), Postives = 58/80 (72.50%), Query Frame = 0
BLAST of CsGy4G000300 vs. NCBI nr
Match: Q43667.1 (RecName: Full=Trypsin inhibitor 1; AltName: Full=TTII; AltName: Full=Trypsin inhibitor I; Flags: Precursor >CAA57704.1 Trichosanthes trypsin inhibitor-I [Trichosanthes kirilowii]) HSP 1 Score: 84.7 bits (208), Expect = 1.5e-13 Identity = 39/65 (60.00%), Postives = 46/65 (70.77%), Query Frame = 0
BLAST of CsGy4G000300 vs. NCBI nr
Match: KGN52760.1 (hypothetical protein Csa_4G000805 [Cucumis sativus]) HSP 1 Score: 69.3 bits (168), Expect = 6.6e-09 Identity = 33/83 (39.76%), Postives = 51/83 (61.45%), Query Frame = 0
BLAST of CsGy4G000300 vs. Swiss-Prot
Match: sp|Q43667|ITR1_TRIKI (Trypsin inhibitor 1 OS=Trichosanthes kirilowii OX=3677 PE=3 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 5.0e-16 Identity = 39/65 (60.00%), Postives = 46/65 (70.77%), Query Frame = 0
BLAST of CsGy4G000300 vs. Swiss-Prot
Match: sp|P34950|ITR5_LUFAE (Trypsin inhibitor 5 OS=Luffa aegyptiaca OX=3670 PE=1 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.8e-10 Identity = 33/66 (50.00%), Postives = 43/66 (65.15%), Query Frame = 0
BLAST of CsGy4G000300 vs. Swiss-Prot
Match: sp|P11968|ITR2_BRYDI (Trypsin inhibitor 2 OS=Bryonia dioica OX=3652 PE=1 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 8.5e-08 Identity = 21/28 (75.00%), Postives = 24/28 (85.71%), Query Frame = 0
BLAST of CsGy4G000300 vs. Swiss-Prot
Match: sp|P12071|ITR2_ECBEL (Trypsin inhibitor 2 OS=Ecballium elaterium OX=3679 PE=1 SV=2) HSP 1 Score: 53.5 bits (127), Expect = 1.2e-06 Identity = 20/28 (71.43%), Postives = 22/28 (78.57%), Query Frame = 0
BLAST of CsGy4G000300 vs. Swiss-Prot
Match: sp|P17680|ITR1_MOMRE (Trypsin inhibitor 1 OS=Momordica repens OX=3675 PE=1 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 2.1e-06 Identity = 20/27 (74.07%), Postives = 21/27 (77.78%), Query Frame = 0
BLAST of CsGy4G000300 vs. TrEMBL
Match: tr|A0A0A0KY34|A0A0A0KY34_CUCSA (Trypsin inhibitor 1 OS=Cucumis sativus OX=3659 GN=Csa_4G000810 PE=3 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 3.1e-31 Identity = 69/81 (85.19%), Postives = 73/81 (90.12%), Query Frame = 0
BLAST of CsGy4G000300 vs. TrEMBL
Match: tr|A0A0A0KT01|A0A0A0KT01_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G000805 PE=3 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 4.4e-09 Identity = 33/83 (39.76%), Postives = 51/83 (61.45%), Query Frame = 0
BLAST of CsGy4G000300 vs. TrEMBL
Match: tr|Q9S8D2|Q9S8D2_CUCME (CMETI-B=TRYPSIN inhibitor OS=Cucumis melo OX=3656 PE=3 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 8.3e-08 Identity = 25/29 (86.21%), Postives = 27/29 (93.10%), Query Frame = 0
BLAST of CsGy4G000300 vs. TrEMBL
Match: tr|J7IN40|J7IN40_9ROSI (Two inhibitor peptide topologies 2 OS=Momordica sphaeroidea OX=703389 GN=TIPTOP2 PE=3 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 7.8e-06 Identity = 34/80 (42.50%), Postives = 45/80 (56.25%), Query Frame = 0
BLAST of CsGy4G000300 vs. TrEMBL
Match: tr|A0A0A7HIA9|A0A0A7HIA9_9ROSI (TIPRE5 (Fragment) OS=Momordica friesiorum OX=703365 GN=TIPRE5 PE=3 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 8.6e-05 Identity = 29/77 (37.66%), Postives = 43/77 (55.84%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |