CsGy3G019100 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: five_prime_UTRexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.CGCCTCCATTGCTGAGATTATCCCATCACAGATTTTATTCAATATCCGCCGGTTTCCCTATTTGAGGGTTTTCAATATCTTGTTTTGGGCATGGAGAACCAGTTTTTTTCCATTTTTCAACGAAACCCATGTTGGGATCAAAGGTTTATAGTCTTTGCTTTGATCTTCCTCTCTCTCACTTGCTCCTTCTCACCTTCCTGTAAGTATATTCCTCTCTCTAATTTTGTACGGTCATGCATATTTGTGTTCTGTTTTGTCTGTGGATTATGAGGGGATAGAAGAAATTTAATACAAAAGCGTAGGTTGAAATGCAGATGGATATGATTCATTGGACCCTTATGCTAACATTACAATCACTTGGGATTTCTTGGTAGAGAATGGGGATACTTATGATGTA CGCCTCCATTGCTGAGATTATCCCATCACAGATTTTATTCAATATCCGCCGGTTTCCCTATTTGAGGGTTTTCAATATCTTGTTTTGGGCATGGAGAACCAGTTTTTTTCCATTTTTCAACGAAACCCATGTTGGGATCAAAGGTTTATAGTCTTTGCTTTGATCTTCCTCTCTCTCACTTGCTCCTTCTCACCTTCCTATGGATATGATTCATTGGACCCTTATGCTAACATTACAATCACTTGGGATTTCTTGGTAGAGAATGGGGATACTTATGATGTA ATGGAGAACCAGTTTTTTTCCATTTTTCAACGAAACCCATGTTGGGATCAAAGGTTTATAGTCTTTGCTTTGATCTTCCTCTCTCTCACTTGCTCCTTCTCACCTTCCTATGGATATGATTCATTGGACCCTTATGCTAACATTACAATCACTTGGGATTTCTTGGTAGAGAATGGGGATACTTATGATGTA MENQFFSIFQRNPCWDQRFIVFALIFLSLTCSFSPSYGYDSLDPYANITITWDFLVENGDTYDV
BLAST of CsGy3G019100 vs. NCBI nr
Match: XP_011651285.1 (PREDICTED: COBRA-like protein 6 [Cucumis sativus]) HSP 1 Score: 138.7 bits (348), Expect = 7.1e-30 Identity = 63/64 (98.44%), Postives = 63/64 (98.44%), Query Frame = 0
BLAST of CsGy3G019100 vs. NCBI nr
Match: XP_008456042.2 (PREDICTED: COBRA-like protein 6, partial [Cucumis melo]) HSP 1 Score: 125.9 bits (315), Expect = 4.8e-26 Identity = 58/60 (96.67%), Postives = 59/60 (98.33%), Query Frame = 0
BLAST of CsGy3G019100 vs. NCBI nr
Match: XP_023533604.1 (COBRA-like protein 6 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 110.5 bits (275), Expect = 2.1e-21 Identity = 54/68 (79.41%), Postives = 57/68 (83.82%), Query Frame = 0
BLAST of CsGy3G019100 vs. NCBI nr
Match: XP_022942251.1 (COBRA-like protein 6 [Cucurbita moschata]) HSP 1 Score: 107.5 bits (267), Expect = 1.8e-20 Identity = 53/68 (77.94%), Postives = 56/68 (82.35%), Query Frame = 0
BLAST of CsGy3G019100 vs. NCBI nr
Match: XP_022980772.1 (COBRA-like protein 6 [Cucurbita maxima]) HSP 1 Score: 105.5 bits (262), Expect = 6.7e-20 Identity = 52/68 (76.47%), Postives = 56/68 (82.35%), Query Frame = 0
BLAST of CsGy3G019100 vs. TAIR10
Match: AT3G29810.1 (COBRA-like protein 2 precursor) HSP 1 Score: 42.4 bits (98), Expect = 1.3e-04 Identity = 20/43 (46.51%), Postives = 27/43 (62.79%), Query Frame = 0
BLAST of CsGy3G019100 vs. TAIR10
Match: AT3G02210.1 (COBRA-like protein 1 precursor) HSP 1 Score: 42.0 bits (97), Expect = 1.6e-04 Identity = 18/40 (45.00%), Postives = 23/40 (57.50%), Query Frame = 0
BLAST of CsGy3G019100 vs. TrEMBL
Match: tr|A0A1S3C1W1|A0A1S3C1W1_CUCME (COBRA-like protein OS=Cucumis melo OX=3656 GN=LOC103496092 PE=3 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 3.2e-26 Identity = 58/60 (96.67%), Postives = 59/60 (98.33%), Query Frame = 0
BLAST of CsGy3G019100 vs. TrEMBL
Match: tr|A0A251RJN2|A0A251RJN2_PRUPE (COBRA-like protein OS=Prunus persica OX=3760 GN=PRUPE_1G575900 PE=3 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 1.0e-08 Identity = 29/45 (64.44%), Postives = 35/45 (77.78%), Query Frame = 0
BLAST of CsGy3G019100 vs. TrEMBL
Match: tr|A0A2N9ENP1|A0A2N9ENP1_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS4297 PE=4 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 1.5e-07 Identity = 31/45 (68.89%), Postives = 32/45 (71.11%), Query Frame = 0
BLAST of CsGy3G019100 vs. TrEMBL
Match: tr|W9RIK2|W9RIK2_9ROSA (COBRA-like protein OS=Morus notabilis OX=981085 GN=L484_006961 PE=3 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.2e-06 Identity = 27/44 (61.36%), Postives = 33/44 (75.00%), Query Frame = 0
BLAST of CsGy3G019100 vs. TrEMBL
Match: tr|A0A2K3N130|A0A2K3N130_TRIPR (Cobra-like protein 1-like OS=Trifolium pratense OX=57577 GN=L195_g019945 PE=4 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 3.6e-06 Identity = 29/46 (63.04%), Postives = 33/46 (71.74%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|