CsGy3G012550 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCCATCGATTGCAAAGGTACGAAAGTCAGACTTGTTGTTTCATAGTTGCTTTTAGTTATTTGTGTGAGTTTTATCTATACATTTTGTTTCTCATCAGAAATTTTTATAACAAATAGGACATGTTTAATTATATTTTGAAGATGGAAGGGGAGGTAATTTTATTTTATTTTCCTTACTCAAATGGTTAATTAATTATTTATTTGTTCATTGGCCATTAATACAGGTAAGAGCTCTTGGCCTGAGTTGGTTGGAGTTTCGGGTAACATTGCTGAAAAGATTATCGAAAAAGAGAACTGTTATGTTAACGCGATCATTGTTGAACAAGGAAAATTTGTTACACAAGATTTCAGGTGTGATAGGGTTTGGGTTTGGGTGGATAAACACACCCATATTGTTATTAAGACTCCCATAATTGGTTAA ATGTCCATCGATTGCAAAGGTAAGAGCTCTTGGCCTGAGTTGGTTGGAGTTTCGGGTAACATTGCTGAAAAGATTATCGAAAAAGAGAACTGTTATGTTAACGCGATCATTGTTGAACAAGGAAAATTTGTTACACAAGATTTCAGGTGTGATAGGGTTTGGGTTTGGGTGGATAAACACACCCATATTGTTATTAAGACTCCCATAATTGGTTAA ATGTCCATCGATTGCAAAGGTAAGAGCTCTTGGCCTGAGTTGGTTGGAGTTTCGGGTAACATTGCTGAAAAGATTATCGAAAAAGAGAACTGTTATGTTAACGCGATCATTGTTGAACAAGGAAAATTTGTTACACAAGATTTCAGGTGTGATAGGGTTTGGGTTTGGGTGGATAAACACACCCATATTGTTATTAAGACTCCCATAATTGGTTAA MSIDCKGKSSWPELVGVSGNIAEKIIEKENCYVNAIIVEQGKFVTQDFRCDRVWVWVDKHTHIVIKTPIIG
BLAST of CsGy3G012550 vs. NCBI nr
Match: KGN56905.1 (hypothetical protein Csa_3G142970 [Cucumis sativus]) HSP 1 Score: 154.8 bits (390), Expect = 1.1e-34 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 0
BLAST of CsGy3G012550 vs. NCBI nr
Match: XP_016898985.1 (PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis melo]) HSP 1 Score: 141.7 bits (356), Expect = 9.3e-31 Identity = 66/71 (92.96%), Postives = 68/71 (95.77%), Query Frame = 0
BLAST of CsGy3G012550 vs. NCBI nr
Match: XP_004134090.1 (PREDICTED: glu S.griseus protease inhibitor-like [Cucumis sativus] >KGN56904.1 hypothetical protein Csa_3G142960 [Cucumis sativus]) HSP 1 Score: 110.9 bits (276), Expect = 1.8e-21 Identity = 51/71 (71.83%), Postives = 57/71 (80.28%), Query Frame = 0
BLAST of CsGy3G012550 vs. NCBI nr
Match: POE98893.1 (glu s.griseus protease inhibitor [Quercus suber]) HSP 1 Score: 101.7 bits (252), Expect = 1.1e-18 Identity = 47/71 (66.20%), Postives = 55/71 (77.46%), Query Frame = 0
BLAST of CsGy3G012550 vs. NCBI nr
Match: POE98891.1 (glu s.griseus protease inhibitor [Quercus suber]) HSP 1 Score: 98.2 bits (243), Expect = 1.2e-17 Identity = 45/71 (63.38%), Postives = 56/71 (78.87%), Query Frame = 0
BLAST of CsGy3G012550 vs. TAIR10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 76.6 bits (187), Expect = 6.7e-15 Identity = 38/71 (53.52%), Postives = 49/71 (69.01%), Query Frame = 0
BLAST of CsGy3G012550 vs. TAIR10
Match: AT2G38900.2 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 69.7 bits (169), Expect = 8.2e-13 Identity = 30/65 (46.15%), Postives = 44/65 (67.69%), Query Frame = 0
BLAST of CsGy3G012550 vs. TAIR10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 67.0 bits (162), Expect = 5.3e-12 Identity = 32/65 (49.23%), Postives = 45/65 (69.23%), Query Frame = 0
BLAST of CsGy3G012550 vs. TAIR10
Match: AT3G46860.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 51.2 bits (121), Expect = 3.0e-07 Identity = 26/64 (40.62%), Postives = 41/64 (64.06%), Query Frame = 0
BLAST of CsGy3G012550 vs. TAIR10
Match: AT5G43570.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 42.4 bits (98), Expect = 1.4e-04 Identity = 25/62 (40.32%), Postives = 32/62 (51.61%), Query Frame = 0
BLAST of CsGy3G012550 vs. Swiss-Prot
Match: sp|P19873|ITH5_CUCMA (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 6.4e-15 Identity = 37/67 (55.22%), Postives = 51/67 (76.12%), Query Frame = 0
BLAST of CsGy3G012550 vs. Swiss-Prot
Match: sp|P82381|ICI_LINUS (Proteinase inhibitor OS=Linum usitatissimum OX=4006 PE=1 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 7.1e-14 Identity = 32/56 (57.14%), Postives = 45/56 (80.36%), Query Frame = 0
BLAST of CsGy3G012550 vs. Swiss-Prot
Match: sp|P24076|BGIA_MOMCH (Glu S.griseus protease inhibitor OS=Momordica charantia OX=3673 PE=1 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 4.6e-13 Identity = 37/67 (55.22%), Postives = 46/67 (68.66%), Query Frame = 0
BLAST of CsGy3G012550 vs. Swiss-Prot
Match: sp|P80211|ATSI_AMACA (Trypsin/subtilisin inhibitor OS=Amaranthus caudatus OX=3567 PE=1 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 6.6e-12 Identity = 34/65 (52.31%), Postives = 43/65 (66.15%), Query Frame = 0
BLAST of CsGy3G012550 vs. Swiss-Prot
Match: sp|Q6XNP7|HPI_HEVBR (Protease inhibitor HPI OS=Hevea brasiliensis OX=3981 GN=PI1 PE=1 SV=2) HSP 1 Score: 68.6 bits (166), Expect = 3.3e-11 Identity = 34/71 (47.89%), Postives = 49/71 (69.01%), Query Frame = 0
BLAST of CsGy3G012550 vs. TrEMBL
Match: tr|A0A0A0L4J0|A0A0A0L4J0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142970 PE=4 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 7.1e-35 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 0
BLAST of CsGy3G012550 vs. TrEMBL
Match: tr|A0A1S4DTF7|A0A1S4DTF7_CUCME (inhibitor of trypsin and hageman factor-like OS=Cucumis melo OX=3656 GN=LOC103483638 PE=4 SV=1) HSP 1 Score: 141.7 bits (356), Expect = 6.2e-31 Identity = 66/71 (92.96%), Postives = 68/71 (95.77%), Query Frame = 0
BLAST of CsGy3G012550 vs. TrEMBL
Match: tr|A0A0A0L795|A0A0A0L795_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142960 PE=4 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 1.2e-21 Identity = 51/71 (71.83%), Postives = 57/71 (80.28%), Query Frame = 0
BLAST of CsGy3G012550 vs. TrEMBL
Match: tr|A0A2P4L0Z6|A0A2P4L0Z6_QUESU (Glu s.griseus protease inhibitor OS=Quercus suber OX=58331 GN=CFP56_44655 PE=4 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 7.1e-19 Identity = 47/71 (66.20%), Postives = 55/71 (77.46%), Query Frame = 0
BLAST of CsGy3G012550 vs. TrEMBL
Match: tr|A0A2P4L0Z7|A0A2P4L0Z7_QUESU (Glu s.griseus protease inhibitor OS=Quercus suber OX=58331 GN=CFP56_44653 PE=4 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 7.8e-18 Identity = 45/71 (63.38%), Postives = 56/71 (78.87%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |