CsGy3G012470 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATGAAGAATTTGATACAAGTAAGTCCATTATAAATACTCACCCTATCAAATTGCTTTTAATTTTTCAAAAATATTTGTTCCAAAGTTGTTTTAATTTCAAAACAATTTGTTTTTGAGTATTTTGTTTCGACTTCCATTAAATATATGGTCTGTAAACTAACATAAATTTGATCAACTATCACAAGTATTGGAAGTCAAATGATATCAATTCAATACACACCAAAACGATACCCCGATACCTGTTTATGCAATTTGAGTTATATTCTATCCAAGGGTATACTTTGGTTGGATTTTAGATTATATCTATTTGCAAAATTTAACATATAATCTATATATAATTCTTAAATAGGAAAATCTATATGGCCAGAGCTTGTTGGCGTAGACTTTTCTGCTGCTGCTAGGATAATAGAAACAGAGAATCCCAATGTGAAGGCTACCAAGATTCTAATCGGTAGTCCCGTGATTCTGAATTATGATCCTACCCGAGTTTGGGTTATTTACAATACAGAAGATAAGGTTGTTGACATACCCCGCGTCGGTTAA ATGGATGAAGAATTTGATACAAGAAAATCTATATGGCCAGAGCTTGTTGGCGTAGACTTTTCTGCTGCTGCTAGGATAATAGAAACAGAGAATCCCAATGTGAAGGCTACCAAGATTCTAATCGGTAGTCCCGTGATTCTGAATTATGATCCTACCCGAGTTTGGGTTATTTACAATACAGAAGATAAGGTTGTTGACATACCCCGCGTCGGTTAA ATGGATGAAGAATTTGATACAAGAAAATCTATATGGCCAGAGCTTGTTGGCGTAGACTTTTCTGCTGCTGCTAGGATAATAGAAACAGAGAATCCCAATGTGAAGGCTACCAAGATTCTAATCGGTAGTCCCGTGATTCTGAATTATGATCCTACCCGAGTTTGGGTTATTTACAATACAGAAGATAAGGTTGTTGACATACCCCGCGTCGGTTAA MDEEFDTRKSIWPELVGVDFSAAARIIETENPNVKATKILIGSPVILNYDPTRVWVIYNTEDKVVDIPRVG
BLAST of CsGy3G012470 vs. NCBI nr
Match: KGN56896.1 (hypothetical protein Csa_3G142410 [Cucumis sativus]) HSP 1 Score: 144.4 bits (363), Expect = 1.4e-31 Identity = 70/71 (98.59%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of CsGy3G012470 vs. NCBI nr
Match: KGN56895.1 (Protease inhibitor protein [Cucumis sativus]) HSP 1 Score: 89.7 bits (221), Expect = 4.2e-15 Identity = 43/71 (60.56%), Postives = 54/71 (76.06%), Query Frame = 0
BLAST of CsGy3G012470 vs. NCBI nr
Match: KGN56894.1 (hypothetical protein Csa_3G141900 [Cucumis sativus]) HSP 1 Score: 85.5 bits (210), Expect = 7.9e-14 Identity = 43/71 (60.56%), Postives = 52/71 (73.24%), Query Frame = 0
BLAST of CsGy3G012470 vs. NCBI nr
Match: KGN56897.1 (hypothetical protein Csa_3G142910 [Cucumis sativus]) HSP 1 Score: 81.3 bits (199), Expect = 1.5e-12 Identity = 42/71 (59.15%), Postives = 50/71 (70.42%), Query Frame = 0
BLAST of CsGy3G012470 vs. NCBI nr
Match: XP_021282806.1 (oxygen-evolving enhancer protein 2, chloroplastic-like [Herrania umbratica]) HSP 1 Score: 67.4 bits (163), Expect = 2.2e-08 Identity = 33/65 (50.77%), Postives = 41/65 (63.08%), Query Frame = 0
BLAST of CsGy3G012470 vs. TAIR10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 52.8 bits (125), Expect = 1.0e-07 Identity = 29/64 (45.31%), Postives = 36/64 (56.25%), Query Frame = 0
BLAST of CsGy3G012470 vs. TAIR10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 49.7 bits (117), Expect = 8.8e-07 Identity = 29/66 (43.94%), Postives = 37/66 (56.06%), Query Frame = 0
BLAST of CsGy3G012470 vs. Swiss-Prot
Match: sp|P19873|ITH5_CUCMA (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 1.7e-07 Identity = 30/63 (47.62%), Postives = 37/63 (58.73%), Query Frame = 0
BLAST of CsGy3G012470 vs. Swiss-Prot
Match: sp|Q6XNP7|HPI_HEVBR (Protease inhibitor HPI OS=Hevea brasiliensis OX=3981 GN=PI1 PE=1 SV=2) HSP 1 Score: 51.2 bits (121), Expect = 5.4e-06 Identity = 26/63 (41.27%), Postives = 36/63 (57.14%), Query Frame = 0
BLAST of CsGy3G012470 vs. Swiss-Prot
Match: sp|Q02214|ITR1_NICSY (Trypsin inhibitor 1 OS=Nicotiana sylvestris OX=4096 PE=2 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 7.1e-06 Identity = 28/65 (43.08%), Postives = 36/65 (55.38%), Query Frame = 0
BLAST of CsGy3G012470 vs. Swiss-Prot
Match: sp|P05118|ICI1_SOLLC (Wound-induced proteinase inhibitor 1 OS=Solanum lycopersicum OX=4081 GN=PIIF PE=2 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 9.3e-06 Identity = 31/74 (41.89%), Postives = 42/74 (56.76%), Query Frame = 0
BLAST of CsGy3G012470 vs. Swiss-Prot
Match: sp|P08454|ICID_SOLTU (Wound-induced proteinase inhibitor 1 OS=Solanum tuberosum OX=4113 PE=1 SV=2) HSP 1 Score: 50.4 bits (119), Expect = 9.3e-06 Identity = 31/72 (43.06%), Postives = 41/72 (56.94%), Query Frame = 0
BLAST of CsGy3G012470 vs. TrEMBL
Match: tr|A0A0A0L9Z4|A0A0A0L9Z4_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142410 PE=4 SV=1) HSP 1 Score: 144.4 bits (363), Expect = 9.5e-32 Identity = 70/71 (98.59%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of CsGy3G012470 vs. TrEMBL
Match: tr|A0A0A0L4I0|A0A0A0L4I0_CUCSA (Protease inhibitor protein OS=Cucumis sativus OX=3659 GN=Csa_3G142400 PE=4 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 2.8e-15 Identity = 43/71 (60.56%), Postives = 54/71 (76.06%), Query Frame = 0
BLAST of CsGy3G012470 vs. TrEMBL
Match: tr|A0A0A0L785|A0A0A0L785_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G141900 PE=4 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 5.3e-14 Identity = 43/71 (60.56%), Postives = 52/71 (73.24%), Query Frame = 0
BLAST of CsGy3G012470 vs. TrEMBL
Match: tr|A0A0A0L8E6|A0A0A0L8E6_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142910 PE=4 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 9.9e-13 Identity = 42/71 (59.15%), Postives = 50/71 (70.42%), Query Frame = 0
BLAST of CsGy3G012470 vs. TrEMBL
Match: tr|V4S3E1|V4S3E1_9ROSI (Uncharacterized protein OS=Citrus clementina OX=85681 GN=CICLE_v10006203mg PE=4 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 1.6e-07 Identity = 35/66 (53.03%), Postives = 43/66 (65.15%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |