CsGy3G001760 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGTTGAAGATGATGATGAATTGGTTGGTGTTGATATTTGGAGGTTTAGTTTTAGTTTTCGGAGTTTTGAAGAGATTGAATGATTGGTATTATGAAGTTAAGCTTGGGAAACTATGGCCTAAGCTTCCTCCTGGTCATATGGGTTGGCCTTTTGTTGGTTCTACTCTATCTTTCATCAAAGATTACACTTCTGGTCAACCTCAGAATTTCGTTAAAGCCCTTCAGATCAGGTTGCATTTGATCTCCCAACTCTTTTTTTGTTGTTGTTTTTCAGTTTAATTATATGTGTCGATTCTATCCTTTTTTTATTATCGAGATCAATATTACATTTTTTTAG ATGGAGTTGAAGATGATGATGAATTGGTTGGTGTTGATATTTGGAGGTTTAGTTTTAGTTTTCGGAGTTTTGAAGAGATTGAATGATTGGTATTATGAAGTTAAGCTTGGGAAACTATGGCCTAAGCTTCCTCCTGGTCATATGGGTTGGCCTTTTGTTGGTTCTACTCTATCTTTCATCAAAGATTACACTTCTGGTCAACCTCAGAATTTCTTTAATTATATGTGTCGATTCTATCCTTTTTTTATTATCGAGATCAATATTACATTTTTTTAG ATGGAGTTGAAGATGATGATGAATTGGTTGGTGTTGATATTTGGAGGTTTAGTTTTAGTTTTCGGAGTTTTGAAGAGATTGAATGATTGGTATTATGAAGTTAAGCTTGGGAAACTATGGCCTAAGCTTCCTCCTGGTCATATGGGTTGGCCTTTTGTTGGTTCTACTCTATCTTTCATCAAAGATTACACTTCTGGTCAACCTCAGAATTTCTTTAATTATATGTGTCGATTCTATCCTTTTTTTATTATCGAGATCAATATTACATTTTTTTAG MELKMMMNWLVLIFGGLVLVFGVLKRLNDWYYEVKLGKLWPKLPPGHMGWPFVGSTLSFIKDYTSGQPQNFFNYMCRFYPFFIIEINITFF
BLAST of CsGy3G001760 vs. NCBI nr
Match: KGN55784.1 (hypothetical protein Csa_3G011850 [Cucumis sativus]) HSP 1 Score: 155.2 bits (391), Expect = 1.0e-34 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 0
BLAST of CsGy3G001760 vs. NCBI nr
Match: XP_008448714.1 (PREDICTED: beta-amyrin 11-oxidase-like [Cucumis melo]) HSP 1 Score: 140.2 bits (352), Expect = 3.5e-30 Identity = 64/72 (88.89%), Postives = 70/72 (97.22%), Query Frame = 0
BLAST of CsGy3G001760 vs. NCBI nr
Match: XP_008448712.1 (PREDICTED: beta-amyrin 11-oxidase-like isoform X1 [Cucumis melo]) HSP 1 Score: 112.5 bits (280), Expect = 7.8e-22 Identity = 50/69 (72.46%), Postives = 57/69 (82.61%), Query Frame = 0
BLAST of CsGy3G001760 vs. NCBI nr
Match: XP_008448713.1 (PREDICTED: beta-amyrin 11-oxidase-like isoform X2 [Cucumis melo]) HSP 1 Score: 112.5 bits (280), Expect = 7.8e-22 Identity = 50/69 (72.46%), Postives = 57/69 (82.61%), Query Frame = 0
BLAST of CsGy3G001760 vs. NCBI nr
Match: KGN55786.1 (hypothetical protein Csa_3G012860 [Cucumis sativus]) HSP 1 Score: 110.9 bits (276), Expect = 2.3e-21 Identity = 49/69 (71.01%), Postives = 58/69 (84.06%), Query Frame = 0
BLAST of CsGy3G001760 vs. TAIR10
Match: AT2G32440.1 (ent-kaurenoic acid hydroxylase 2) HSP 1 Score: 62.8 bits (151), Expect = 1.3e-10 Identity = 30/78 (38.46%), Postives = 49/78 (62.82%), Query Frame = 0
BLAST of CsGy3G001760 vs. TAIR10
Match: AT1G05160.1 (cytochrome P450, family 88, subfamily A, polypeptide 3) HSP 1 Score: 55.5 bits (132), Expect = 2.0e-08 Identity = 24/71 (33.80%), Postives = 42/71 (59.15%), Query Frame = 0
BLAST of CsGy3G001760 vs. TAIR10
Match: AT3G44970.1 (Cytochrome P450 superfamily protein) HSP 1 Score: 44.7 bits (104), Expect = 3.6e-05 Identity = 24/68 (35.29%), Postives = 35/68 (51.47%), Query Frame = 0
BLAST of CsGy3G001760 vs. TAIR10
Match: AT1G65670.1 (cytochrome P450, family 702, subfamily A, polypeptide 1) HSP 1 Score: 43.5 bits (101), Expect = 8.0e-05 Identity = 24/66 (36.36%), Postives = 36/66 (54.55%), Query Frame = 0
BLAST of CsGy3G001760 vs. TAIR10
Match: AT3G13730.1 (cytochrome P450, family 90, subfamily D, polypeptide 1) HSP 1 Score: 43.5 bits (101), Expect = 8.0e-05 Identity = 18/49 (36.73%), Postives = 28/49 (57.14%), Query Frame = 0
BLAST of CsGy3G001760 vs. Swiss-Prot
Match: sp|B5BSX1|BAMO_GLYUR (Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis OX=74613 GN=CYP88D6 PE=1 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 3.2e-11 Identity = 34/79 (43.04%), Postives = 50/79 (63.29%), Query Frame = 0
BLAST of CsGy3G001760 vs. Swiss-Prot
Match: sp|Q9C5Y2|KAO2_ARATH (Ent-kaurenoic acid oxidase 2 OS=Arabidopsis thaliana OX=3702 GN=KAO2 PE=2 SV=2) HSP 1 Score: 62.8 bits (151), Expect = 2.3e-09 Identity = 30/78 (38.46%), Postives = 49/78 (62.82%), Query Frame = 0
BLAST of CsGy3G001760 vs. Swiss-Prot
Match: sp|Q5VRM7|KAO_ORYSJ (Ent-kaurenoic acid oxidase OS=Oryza sativa subsp. japonica OX=39947 GN=KAO PE=1 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 2.8e-07 Identity = 28/68 (41.18%), Postives = 42/68 (61.76%), Query Frame = 0
BLAST of CsGy3G001760 vs. Swiss-Prot
Match: sp|O23051|KAO1_ARATH (Ent-kaurenoic acid oxidase 1 OS=Arabidopsis thaliana OX=3702 GN=KAO1 PE=2 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 3.7e-07 Identity = 24/71 (33.80%), Postives = 42/71 (59.15%), Query Frame = 0
BLAST of CsGy3G001760 vs. Swiss-Prot
Match: sp|Q9AXH9|KAO1_HORVU (Ent-kaurenoic acid oxidase 1 OS=Hordeum vulgare OX=4513 GN=KAO1 PE=1 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 5.9e-05 Identity = 21/62 (33.87%), Postives = 35/62 (56.45%), Query Frame = 0
BLAST of CsGy3G001760 vs. TrEMBL
Match: tr|A0A0A0L415|A0A0A0L415_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G011850 PE=4 SV=1) HSP 1 Score: 155.2 bits (391), Expect = 6.9e-35 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 0
BLAST of CsGy3G001760 vs. TrEMBL
Match: tr|A0A1S3BKC3|A0A1S3BKC3_CUCME (beta-amyrin 11-oxidase-like OS=Cucumis melo OX=3656 GN=LOC103490802 PE=3 SV=1) HSP 1 Score: 140.2 bits (352), Expect = 2.3e-30 Identity = 64/72 (88.89%), Postives = 70/72 (97.22%), Query Frame = 0
BLAST of CsGy3G001760 vs. TrEMBL
Match: tr|A0A1S3BKD0|A0A1S3BKD0_CUCME (beta-amyrin 11-oxidase-like isoform X2 OS=Cucumis melo OX=3656 GN=LOC103490801 PE=3 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 5.1e-22 Identity = 50/69 (72.46%), Postives = 57/69 (82.61%), Query Frame = 0
BLAST of CsGy3G001760 vs. TrEMBL
Match: tr|A0A1S3BJR1|A0A1S3BJR1_CUCME (beta-amyrin 11-oxidase-like isoform X1 OS=Cucumis melo OX=3656 GN=LOC103490801 PE=3 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 5.1e-22 Identity = 50/69 (72.46%), Postives = 57/69 (82.61%), Query Frame = 0
BLAST of CsGy3G001760 vs. TrEMBL
Match: tr|A0A0A0L6L5|A0A0A0L6L5_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G012860 PE=4 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 1.5e-21 Identity = 49/69 (71.01%), Postives = 58/69 (84.06%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |