CsGy2G026550 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATTCATGAAGAGAAAAGCCAAGAAGATCATCATCTTGGCTCCTCCTCCACTGATGGCCCAGCTTTTCCATTTCACAAGCTGCTTGTTTATGCTGATGCTTTGGATTGGGTTTTAATGGGTTTAGGGACTTTTGGTTCTGTCATTCATGGCATGGCTCAGCCAATTGGGTATCTTTTGCTTGGCAAAGCACTTGATGCATTTGGAAATAATATTGATGATATTGATGCAATGGTTGATGCACTCTATGAGGTATATTTATTAATTCTATTTGTGCCTACTTTTTATTTATTTATTTATTGTTTTTACTTCATGATATTGTTTTTTTTACAACATATAGTTTTGGAATATTATATAA ATGATTCATGAAGAGAAAAGCCAAGAAGATCATCATCTTGGCTCCTCCTCCACTGATGGCCCAGCTTTTCCATTTCACAAGCTGCTTGTTTATGCTGATGCTTTGGATTGGGTTTTAATGGGTTTAGGGACTTTTGGTTCTGTCATTCATGGCATGGCTCAGCCAATTGGGTATCTTTTGCTTGGCAAAGCACTTGATGCATTTGGAAATAATATTGATGATATTGATGCAATGGTTGATGCACTCTATGAGTTTTGGAATATTATATAA ATGATTCATGAAGAGAAAAGCCAAGAAGATCATCATCTTGGCTCCTCCTCCACTGATGGCCCAGCTTTTCCATTTCACAAGCTGCTTGTTTATGCTGATGCTTTGGATTGGGTTTTAATGGGTTTAGGGACTTTTGGTTCTGTCATTCATGGCATGGCTCAGCCAATTGGGTATCTTTTGCTTGGCAAAGCACTTGATGCATTTGGAAATAATATTGATGATATTGATGCAATGGTTGATGCACTCTATGAGTTTTGGAATATTATATAA MIHEEKSQEDHHLGSSSTDGPAFPFHKLLVYADALDWVLMGLGTFGSVIHGMAQPIGYLLLGKALDAFGNNIDDIDAMVDALYEFWNII
BLAST of CsGy2G026550 vs. NCBI nr
Match: KGN63321.1 (hypothetical protein Csa_2G428930 [Cucumis sativus]) HSP 1 Score: 176.8 bits (447), Expect = 3.3e-41 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0
BLAST of CsGy2G026550 vs. NCBI nr
Match: XP_016902931.1 (PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 19-like [Cucumis melo]) HSP 1 Score: 153.3 bits (386), Expect = 3.9e-34 Identity = 77/84 (91.67%), Postives = 78/84 (92.86%), Query Frame = 0
BLAST of CsGy2G026550 vs. NCBI nr
Match: XP_022986167.1 (ABC transporter B family member 19-like [Cucurbita maxima]) HSP 1 Score: 132.5 bits (332), Expect = 7.1e-28 Identity = 67/84 (79.76%), Postives = 70/84 (83.33%), Query Frame = 0
BLAST of CsGy2G026550 vs. NCBI nr
Match: XP_023513249.1 (LOW QUALITY PROTEIN: ABC transporter B family member 13-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 131.3 bits (329), Expect = 1.6e-27 Identity = 67/86 (77.91%), Postives = 71/86 (82.56%), Query Frame = 0
BLAST of CsGy2G026550 vs. NCBI nr
Match: KGN63319.1 (hypothetical protein Csa_2G428910 [Cucumis sativus]) HSP 1 Score: 124.4 bits (311), Expect = 1.9e-25 Identity = 60/84 (71.43%), Postives = 71/84 (84.52%), Query Frame = 0
BLAST of CsGy2G026550 vs. TAIR10
Match: AT3G28860.1 (ATP binding cassette subfamily B19) HSP 1 Score: 57.8 bits (138), Expect = 4.0e-09 Identity = 23/58 (39.66%), Postives = 39/58 (67.24%), Query Frame = 0
BLAST of CsGy2G026550 vs. TAIR10
Match: AT2G47000.1 (ATP binding cassette subfamily B4) HSP 1 Score: 54.7 bits (130), Expect = 3.4e-08 Identity = 24/48 (50.00%), Postives = 34/48 (70.83%), Query Frame = 0
BLAST of CsGy2G026550 vs. TAIR10
Match: AT3G62150.1 (P-glycoprotein 21) HSP 1 Score: 54.7 bits (130), Expect = 3.4e-08 Identity = 25/53 (47.17%), Postives = 34/53 (64.15%), Query Frame = 0
BLAST of CsGy2G026550 vs. TAIR10
Match: AT2G36910.1 (ATP binding cassette subfamily B1) HSP 1 Score: 51.2 bits (121), Expect = 3.8e-07 Identity = 19/61 (31.15%), Postives = 41/61 (67.21%), Query Frame = 0
BLAST of CsGy2G026550 vs. TAIR10
Match: AT3G28345.1 (ABC transporter family protein) HSP 1 Score: 42.4 bits (98), Expect = 1.8e-04 Identity = 17/55 (30.91%), Postives = 32/55 (58.18%), Query Frame = 0
BLAST of CsGy2G026550 vs. Swiss-Prot
Match: sp|Q9LJX0|AB19B_ARATH (ABC transporter B family member 19 OS=Arabidopsis thaliana OX=3702 GN=ABCB19 PE=1 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 7.3e-08 Identity = 23/58 (39.66%), Postives = 39/58 (67.24%), Query Frame = 0
BLAST of CsGy2G026550 vs. Swiss-Prot
Match: sp|Q9M1Q9|AB21B_ARATH (ABC transporter B family member 21 OS=Arabidopsis thaliana OX=3702 GN=ABCB21 PE=1 SV=2) HSP 1 Score: 54.7 bits (130), Expect = 6.2e-07 Identity = 25/53 (47.17%), Postives = 34/53 (64.15%), Query Frame = 0
BLAST of CsGy2G026550 vs. Swiss-Prot
Match: sp|O80725|AB4B_ARATH (ABC transporter B family member 4 OS=Arabidopsis thaliana OX=3702 GN=ABCB4 PE=1 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 6.2e-07 Identity = 24/48 (50.00%), Postives = 34/48 (70.83%), Query Frame = 0
BLAST of CsGy2G026550 vs. Swiss-Prot
Match: sp|Q9ZR72|AB1B_ARATH (ABC transporter B family member 1 OS=Arabidopsis thaliana OX=3702 GN=ABCB1 PE=1 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 6.8e-06 Identity = 19/61 (31.15%), Postives = 41/61 (67.21%), Query Frame = 0
BLAST of CsGy2G026550 vs. TrEMBL
Match: tr|A0A0A0LTG8|A0A0A0LTG8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G428930 PE=4 SV=1) HSP 1 Score: 176.8 bits (447), Expect = 2.2e-41 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0
BLAST of CsGy2G026550 vs. TrEMBL
Match: tr|A0A1S4E3X0|A0A1S4E3X0_CUCME (LOW QUALITY PROTEIN: ABC transporter B family member 19-like OS=Cucumis melo OX=3656 GN=LOC103501134 PE=4 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 2.6e-34 Identity = 77/84 (91.67%), Postives = 78/84 (92.86%), Query Frame = 0
BLAST of CsGy2G026550 vs. TrEMBL
Match: tr|A0A0A0LQN3|A0A0A0LQN3_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G428910 PE=4 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 1.3e-25 Identity = 60/84 (71.43%), Postives = 71/84 (84.52%), Query Frame = 0
BLAST of CsGy2G026550 vs. TrEMBL
Match: tr|A0A1S4E3Y4|A0A1S4E3Y4_CUCME (ABC transporter B family member 19-like OS=Cucumis melo OX=3656 GN=LOC103501136 PE=4 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 6.4e-25 Identity = 61/84 (72.62%), Postives = 71/84 (84.52%), Query Frame = 0
BLAST of CsGy2G026550 vs. TrEMBL
Match: tr|A0A200QFV1|A0A200QFV1_9MAGN (ABC transporter OS=Macleaya cordata OX=56857 GN=BVC80_8743g2 PE=4 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.9e-21 Identity = 55/78 (70.51%), Postives = 62/78 (79.49%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|