CsGy2G014370 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTAGTTGAAGTTGGTCTGTAGTGGTCAAAGAAGTAGGTTGTTGGTGGTAATAACGATATCATAATGAAAATATCAAATTAGAGAAATATTATCCATTCAACACTAAAAGAAAATTTTCTAAAAGTTTGTTTTCAAAATGACCTAATTGTTTATATTAAACATGATTACACTCATCAAACCTATTTTAAACAGTCGTTTAAATGATAACATGATTTTTTTAATAAGCTACGACAAAACAGATATCTTAAAACACGAAATACAATTATGTTTTATTAAATTTTCTACCCTAACAAACAAACTCTAAAGTCGACTGTGATGAGACAGATTTTGATTAATTTTGTTTGTCATTAATGGTGGTGTTTGTATATGCAGGAGGGAATTATAGATGGCCTAACCTAGTAGGTAAGAGATGGCAATATGCTAAAAGGAAAATTGAAGAAGAACTTCCAAGAGTGGGTGTCGCCGTTATGAGAAGAGGGGCGATCAGAATCGAAGATTTCTGTTGCAACCGTGTCATTGTTTACGTCGATGACAGTGGCATTGTTGTTGAAGTCCCAGTCATTGGTTGA ATGGTAGTTGAAGTTGGAGGGAATTATAGATGGCCTAACCTAGTAGGTAAGAGATGGCAATATGCTAAAAGGAAAATTGAAGAAGAACTTCCAAGAGTGGGTGTCGCCGTTATGAGAAGAGGGGCGATCAGAATCGAAGATTTCTGTTGCAACCGTGTCATTGTTTACGTCGATGACAGTGGCATTGTTGTTGAAGTCCCAGTCATTGGTTGA ATGGTAGTTGAAGTTGGAGGGAATTATAGATGGCCTAACCTAGTAGGTAAGAGATGGCAATATGCTAAAAGGAAAATTGAAGAAGAACTTCCAAGAGTGGGTGTCGCCGTTATGAGAAGAGGGGCGATCAGAATCGAAGATTTCTGTTGCAACCGTGTCATTGTTTACGTCGATGACAGTGGCATTGTTGTTGAAGTCCCAGTCATTGGTTGA MVVEVGGNYRWPNLVGKRWQYAKRKIEEELPRVGVAVMRRGAIRIEDFCCNRVIVYVDDSGIVVEVPVIG
BLAST of CsGy2G014370 vs. NCBI nr
Match: KGN62023.1 (hypothetical protein Csa_2G287050 [Cucumis sativus]) HSP 1 Score: 138.7 bits (348), Expect = 7.8e-30 Identity = 66/68 (97.06%), Postives = 66/68 (97.06%), Query Frame = 0
BLAST of CsGy2G014370 vs. NCBI nr
Match: NP_190270.1 (Serine protease inhibitor, potato inhibitor I-type family protein [Arabidopsis thaliana] >CAB51179.1 putative protein [Arabidopsis thaliana] >ABE65997.1 serine protease inhibitor potato inhibitor I-type family protein [Arabidopsis thaliana] >AEE78212.1 Serine protease inhibitor, potato inhibitor I-type family protein [Arabidopsis thaliana] >OAP04666.1 hypothetical protein AXX17_AT3G40770 [Arabidopsis thaliana]) HSP 1 Score: 75.5 bits (184), Expect = 8.1e-11 Identity = 36/66 (54.55%), Postives = 43/66 (65.15%), Query Frame = 0
BLAST of CsGy2G014370 vs. NCBI nr
Match: ABK28590.1 (unknown, partial [Arabidopsis thaliana]) HSP 1 Score: 75.5 bits (184), Expect = 8.1e-11 Identity = 36/66 (54.55%), Postives = 43/66 (65.15%), Query Frame = 0
BLAST of CsGy2G014370 vs. NCBI nr
Match: XP_006404448.1 (inhibitor of trypsin and hageman factor [Eutrema salsugineum] >ESQ45901.1 hypothetical protein EUTSA_v10011055mg [Eutrema salsugineum]) HSP 1 Score: 70.9 bits (172), Expect = 2.0e-09 Identity = 34/66 (51.52%), Postives = 41/66 (62.12%), Query Frame = 0
BLAST of CsGy2G014370 vs. NCBI nr
Match: GAV72328.1 (potato_inhibit domain-containing protein, partial [Cephalotus follicularis]) HSP 1 Score: 66.2 bits (160), Expect = 4.9e-08 Identity = 30/65 (46.15%), Postives = 43/65 (66.15%), Query Frame = 0
BLAST of CsGy2G014370 vs. TAIR10
Match: AT3G46860.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 75.5 bits (184), Expect = 1.5e-14 Identity = 36/66 (54.55%), Postives = 43/66 (65.15%), Query Frame = 0
BLAST of CsGy2G014370 vs. TAIR10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 60.1 bits (144), Expect = 6.4e-10 Identity = 28/69 (40.58%), Postives = 43/69 (62.32%), Query Frame = 0
BLAST of CsGy2G014370 vs. TAIR10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 48.5 bits (114), Expect = 1.9e-06 Identity = 27/60 (45.00%), Postives = 33/60 (55.00%), Query Frame = 0
BLAST of CsGy2G014370 vs. Swiss-Prot
Match: sp|P24076|BGIA_MOMCH (Glu S.griseus protease inhibitor OS=Momordica charantia OX=3673 PE=1 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.4e-06 Identity = 29/64 (45.31%), Postives = 35/64 (54.69%), Query Frame = 0
BLAST of CsGy2G014370 vs. Swiss-Prot
Match: sp|P82381|ICI_LINUS (Proteinase inhibitor OS=Linum usitatissimum OX=4006 PE=1 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 9.1e-06 Identity = 26/63 (41.27%), Postives = 34/63 (53.97%), Query Frame = 0
BLAST of CsGy2G014370 vs. Swiss-Prot
Match: sp|P19873|ITH5_CUCMA (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 9.1e-06 Identity = 26/64 (40.62%), Postives = 35/64 (54.69%), Query Frame = 0
BLAST of CsGy2G014370 vs. Swiss-Prot
Match: sp|P80211|ATSI_AMACA (Trypsin/subtilisin inhibitor OS=Amaranthus caudatus OX=3567 PE=1 SV=1) HSP 1 Score: 45.8 bits (107), Expect = 2.2e-04 Identity = 26/64 (40.62%), Postives = 32/64 (50.00%), Query Frame = 0
BLAST of CsGy2G014370 vs. Swiss-Prot
Match: sp|P20076|IER1_SOLLC (Ethylene-responsive proteinase inhibitor 1 OS=Solanum lycopersicum OX=4081 PE=3 SV=1) HSP 1 Score: 43.9 bits (102), Expect = 8.5e-04 Identity = 23/61 (37.70%), Postives = 38/61 (62.30%), Query Frame = 0
BLAST of CsGy2G014370 vs. TrEMBL
Match: tr|A0A0A0LJT7|A0A0A0LJT7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G287050 PE=4 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 5.2e-30 Identity = 66/68 (97.06%), Postives = 66/68 (97.06%), Query Frame = 0
BLAST of CsGy2G014370 vs. TrEMBL
Match: tr|Q9STF8|Q9STF8_ARATH (Serine protease inhibitor potato inhibitor I-type family protein OS=Arabidopsis thaliana OX=3702 GN=T6H20.110 PE=2 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 5.4e-11 Identity = 36/66 (54.55%), Postives = 43/66 (65.15%), Query Frame = 0
BLAST of CsGy2G014370 vs. TrEMBL
Match: tr|A0A178VFP9|A0A178VFP9_ARATH (Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g40770 PE=4 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 5.4e-11 Identity = 36/66 (54.55%), Postives = 43/66 (65.15%), Query Frame = 0
BLAST of CsGy2G014370 vs. TrEMBL
Match: tr|A0MF11|A0MF11_ARATH (Uncharacterized protein (Fragment) OS=Arabidopsis thaliana OX=3702 PE=2 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 5.4e-11 Identity = 36/66 (54.55%), Postives = 43/66 (65.15%), Query Frame = 0
BLAST of CsGy2G014370 vs. TrEMBL
Match: tr|V4NI49|V4NI49_EUTSA (Uncharacterized protein OS=Eutrema salsugineum OX=72664 GN=EUTSA_v10011055mg PE=4 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 1.3e-09 Identity = 34/66 (51.52%), Postives = 41/66 (62.12%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |