CsGy2G004000 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGATCACCAAATATTTGCAAGTGATTCAGCTCATGCAAAATGGTGGCAAGTTTATGAATCCATGCCCACTGAATTACAACATTTTTGTGGTCTCACAAAGAAGATGGATTCAAGAATAAGAAAATGGAGAAGTATTGCAAGAAATAACTCCACTTTTACCGATGCTCATTGGAAGATCAATATCACTGACCCTAGACGACTCCGTTTTATGGATGATCAGGCTCCTCTTCATCAATAA ATGGAAGATCACCAAATATTTGCAAGTGATTCAGCTCATGCAAAATGGTGGCAAGTTTATGAATCCATGCCCACTGAATTACAACATTTTTGTGGTCTCACAAAGAAGATGGATTCAAGAATAAGAAAATGGAGAAGTATTGCAAGAAATAACTCCACTTTTACCGATGCTCATTGGAAGATCAATATCACTGACCCTAGACGACTCCGTTTTATGGATGATCAGGCTCCTCTTCATCAATAA ATGGAAGATCACCAAATATTTGCAAGTGATTCAGCTCATGCAAAATGGTGGCAAGTTTATGAATCCATGCCCACTGAATTACAACATTTTTGTGGTCTCACAAAGAAGATGGATTCAAGAATAAGAAAATGGAGAAGTATTGCAAGAAATAACTCCACTTTTACCGATGCTCATTGGAAGATCAATATCACTGACCCTAGACGACTCCGTTTTATGGATGATCAGGCTCCTCTTCATCAATAA MEDHQIFASDSAHAKWWQVYESMPTELQHFCGLTKKMDSRIRKWRSIARNNSTFTDAHWKINITDPRRLRFMDDQAPLHQ
BLAST of CsGy2G004000 vs. NCBI nr
Match: XP_004139358.1 (PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 4 [Cucumis sativus] >KGN60903.1 hypothetical protein Csa_2G021740 [Cucumis sativus]) HSP 1 Score: 176.8 bits (447), Expect = 3.0e-41 Identity = 80/80 (100.00%), Postives = 80/80 (100.00%), Query Frame = 0
BLAST of CsGy2G004000 vs. NCBI nr
Match: XP_008454698.1 (PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 4 isoform X2 [Cucumis melo]) HSP 1 Score: 156.8 bits (395), Expect = 3.2e-35 Identity = 70/77 (90.91%), Postives = 71/77 (92.21%), Query Frame = 0
BLAST of CsGy2G004000 vs. NCBI nr
Match: XP_008454693.1 (PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 4 isoform X1 [Cucumis melo] >ABR67414.1 glycosyl transferase [Cucumis melo subsp. melo]) HSP 1 Score: 156.8 bits (395), Expect = 3.2e-35 Identity = 70/77 (90.91%), Postives = 71/77 (92.21%), Query Frame = 0
BLAST of CsGy2G004000 vs. NCBI nr
Match: XP_022150786.1 (putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 4 [Momordica charantia]) HSP 1 Score: 131.0 bits (328), Expect = 1.9e-27 Identity = 60/73 (82.19%), Postives = 64/73 (87.67%), Query Frame = 0
BLAST of CsGy2G004000 vs. NCBI nr
Match: XP_022999266.1 (putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 5 [Cucurbita maxima]) HSP 1 Score: 131.0 bits (328), Expect = 1.9e-27 Identity = 60/74 (81.08%), Postives = 64/74 (86.49%), Query Frame = 0
BLAST of CsGy2G004000 vs. TAIR10
Match: AT1G54940.1 (plant glycogenin-like starch initiation protein 4) HSP 1 Score: 88.2 bits (217), Expect = 2.5e-18 Identity = 35/72 (48.61%), Postives = 50/72 (69.44%), Query Frame = 0
BLAST of CsGy2G004000 vs. TAIR10
Match: AT1G08990.1 (plant glycogenin-like starch initiation protein 5) HSP 1 Score: 81.3 bits (199), Expect = 3.1e-16 Identity = 31/68 (45.59%), Postives = 49/68 (72.06%), Query Frame = 0
BLAST of CsGy2G004000 vs. TAIR10
Match: AT4G33330.2 (plant glycogenin-like starch initiation protein 3) HSP 1 Score: 74.7 bits (182), Expect = 2.9e-14 Identity = 34/68 (50.00%), Postives = 47/68 (69.12%), Query Frame = 0
BLAST of CsGy2G004000 vs. TAIR10
Match: AT3G18660.2 (plant glycogenin-like starch initiation protein 1) HSP 1 Score: 62.4 bits (150), Expect = 1.5e-10 Identity = 27/61 (44.26%), Postives = 37/61 (60.66%), Query Frame = 0
BLAST of CsGy2G004000 vs. Swiss-Prot
Match: sp|Q9FZ37|GUX4_ARATH (Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 4 OS=Arabidopsis thaliana OX=3702 GN=GUX4 PE=3 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 4.5e-17 Identity = 35/72 (48.61%), Postives = 50/72 (69.44%), Query Frame = 0
BLAST of CsGy2G004000 vs. Swiss-Prot
Match: sp|F4HZC3|GUX5_ARATH (Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 5 OS=Arabidopsis thaliana OX=3702 GN=GUX5 PE=2 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 5.5e-15 Identity = 31/68 (45.59%), Postives = 49/68 (72.06%), Query Frame = 0
BLAST of CsGy2G004000 vs. Swiss-Prot
Match: sp|Q8GWW4|GUX2_ARATH (UDP-glucuronate:xylan alpha-glucuronosyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=GUX2 PE=2 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 2.3e-13 Identity = 35/70 (50.00%), Postives = 48/70 (68.57%), Query Frame = 0
BLAST of CsGy2G004000 vs. Swiss-Prot
Match: sp|Q9LSB1|GUX1_ARATH (UDP-glucuronate:xylan alpha-glucuronosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=GUX1 PE=2 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 2.7e-09 Identity = 27/61 (44.26%), Postives = 37/61 (60.66%), Query Frame = 0
BLAST of CsGy2G004000 vs. TrEMBL
Match: tr|A0A0A0LGC4|A0A0A0LGC4_CUCSA (Hexosyltransferase OS=Cucumis sativus OX=3659 GN=Csa_2G021740 PE=3 SV=1) HSP 1 Score: 176.8 bits (447), Expect = 2.0e-41 Identity = 80/80 (100.00%), Postives = 80/80 (100.00%), Query Frame = 0
BLAST of CsGy2G004000 vs. TrEMBL
Match: tr|A0A1S3BZB2|A0A1S3BZB2_CUCME (Hexosyltransferase OS=Cucumis melo OX=3656 GN=LOC103495046 PE=3 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 2.1e-35 Identity = 70/77 (90.91%), Postives = 71/77 (92.21%), Query Frame = 0
BLAST of CsGy2G004000 vs. TrEMBL
Match: tr|A0A1S3BZZ5|A0A1S3BZZ5_CUCME (Hexosyltransferase OS=Cucumis melo OX=3656 GN=LOC103495046 PE=3 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 2.1e-35 Identity = 70/77 (90.91%), Postives = 71/77 (92.21%), Query Frame = 0
BLAST of CsGy2G004000 vs. TrEMBL
Match: tr|A6YTD3|A6YTD3_CUCME (Hexosyltransferase OS=Cucumis melo subsp. melo OX=412675 PE=3 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 2.1e-35 Identity = 70/77 (90.91%), Postives = 71/77 (92.21%), Query Frame = 0
BLAST of CsGy2G004000 vs. TrEMBL
Match: tr|A0A1Q3B583|A0A1Q3B583_CEPFO (Hexosyltransferase OS=Cephalotus follicularis OX=3775 GN=CFOL_v3_06687 PE=3 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.9e-20 Identity = 47/72 (65.28%), Postives = 56/72 (77.78%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|