CsGy1G011100 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATGCAGATTCTATTAAGCGCAAGAGTTTAGATTGGAAAACTCGATACAATATCATACAAGACATTGTTCGAGGACTTATATACCTTCATGAAGACTCTCAACTTCGAATCATTCATCGAGATCTTAAAGCCGGTAACATTTTATTAGATGCAGAGATGAATGCTAAAATTTCTGATTTTGGAACTGCAAAACTATTTGAACATGATCAAACACGAGGAGATACGAGAAAAATCATGGGTACCTAG ATGGATGCAGATTCTATTAAGCGCAAGAGTTTAGATTGGAAAACTCGATACAATATCATACAAGACATTGTTCGAGGACTTATATACCTTCATGAAGACTCTCAACTTCGAATCATTCATCGAGATCTTAAAGCCGGTAACATTTTATTAGATGCAGAGATGAATGCTAAAATTTCTGATTTTGGAACTGCAAAACTATTTGAACATGATCAAACACGAGGAGATACGAGAAAAATCATGGGTACCTAG ATGGATGCAGATTCTATTAAGCGCAAGAGTTTAGATTGGAAAACTCGATACAATATCATACAAGACATTGTTCGAGGACTTATATACCTTCATGAAGACTCTCAACTTCGAATCATTCATCGAGATCTTAAAGCCGGTAACATTTTATTAGATGCAGAGATGAATGCTAAAATTTCTGATTTTGGAACTGCAAAACTATTTGAACATGATCAAACACGAGGAGATACGAGAAAAATCATGGGTACCTAG MDADSIKRKSLDWKTRYNIIQDIVRGLIYLHEDSQLRIIHRDLKAGNILLDAEMNAKISDFGTAKLFEHDQTRGDTRKIMGT
BLAST of CsGy1G011100 vs. NCBI nr
Match: KGN64571.1 (hypothetical protein Csa_1G065420 [Cucumis sativus]) HSP 1 Score: 156.4 bits (394), Expect = 4.2e-35 Identity = 77/79 (97.47%), Postives = 78/79 (98.73%), Query Frame = 0
BLAST of CsGy1G011100 vs. NCBI nr
Match: XP_011648428.1 (PREDICTED: uncharacterized protein LOC101218966 [Cucumis sativus]) HSP 1 Score: 156.4 bits (394), Expect = 4.2e-35 Identity = 77/79 (97.47%), Postives = 78/79 (98.73%), Query Frame = 0
BLAST of CsGy1G011100 vs. NCBI nr
Match: XP_016898896.1 (PREDICTED: cysteine-rich receptor-like protein kinase 28 [Cucumis melo]) HSP 1 Score: 147.5 bits (371), Expect = 2.0e-32 Identity = 70/79 (88.61%), Postives = 75/79 (94.94%), Query Frame = 0
BLAST of CsGy1G011100 vs. NCBI nr
Match: XP_016898897.1 (PREDICTED: uncharacterized protein LOC103489206 [Cucumis melo]) HSP 1 Score: 136.3 bits (342), Expect = 4.5e-29 Identity = 66/77 (85.71%), Postives = 73/77 (94.81%), Query Frame = 0
BLAST of CsGy1G011100 vs. NCBI nr
Match: XP_022139942.1 (putative receptor-like protein kinase At4g00960 [Momordica charantia]) HSP 1 Score: 136.0 bits (341), Expect = 5.9e-29 Identity = 64/79 (81.01%), Postives = 74/79 (93.67%), Query Frame = 0
BLAST of CsGy1G011100 vs. TAIR10
Match: AT4G04540.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 39) HSP 1 Score: 115.5 bits (288), Expect = 1.5e-26 Identity = 53/79 (67.09%), Postives = 65/79 (82.28%), Query Frame = 0
BLAST of CsGy1G011100 vs. TAIR10
Match: AT4G04500.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 37) HSP 1 Score: 114.8 bits (286), Expect = 2.6e-26 Identity = 52/79 (65.82%), Postives = 64/79 (81.01%), Query Frame = 0
BLAST of CsGy1G011100 vs. TAIR10
Match: AT4G04570.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 40) HSP 1 Score: 114.4 bits (285), Expect = 3.3e-26 Identity = 52/79 (65.82%), Postives = 65/79 (82.28%), Query Frame = 0
BLAST of CsGy1G011100 vs. TAIR10
Match: AT4G04490.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 36) HSP 1 Score: 112.8 bits (281), Expect = 9.7e-26 Identity = 52/79 (65.82%), Postives = 63/79 (79.75%), Query Frame = 0
BLAST of CsGy1G011100 vs. TAIR10
Match: AT4G23130.2 (cysteine-rich RLK (RECEPTOR-like protein kinase) 5) HSP 1 Score: 110.2 bits (274), Expect = 6.3e-25 Identity = 50/79 (63.29%), Postives = 63/79 (79.75%), Query Frame = 0
BLAST of CsGy1G011100 vs. Swiss-Prot
Match: sp|Q9SYS7|CRK39_ARATH (Putative cysteine-rich receptor-like protein kinase 39 OS=Arabidopsis thaliana OX=3702 GN=CRK39 PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 2.7e-25 Identity = 53/79 (67.09%), Postives = 65/79 (82.28%), Query Frame = 0
BLAST of CsGy1G011100 vs. Swiss-Prot
Match: sp|Q9XEC7|CRK37_ARATH (Cysteine-rich receptor-like protein kinase 37 OS=Arabidopsis thaliana OX=3702 GN=CRK37 PE=3 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 4.6e-25 Identity = 52/79 (65.82%), Postives = 64/79 (81.01%), Query Frame = 0
BLAST of CsGy1G011100 vs. Swiss-Prot
Match: sp|Q9SYS3|CRK40_ARATH (Cysteine-rich receptor-like protein kinase 40 OS=Arabidopsis thaliana OX=3702 GN=CRK40 PE=2 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 6.0e-25 Identity = 52/79 (65.82%), Postives = 65/79 (82.28%), Query Frame = 0
BLAST of CsGy1G011100 vs. Swiss-Prot
Match: sp|Q9XEC6|CRK36_ARATH (Cysteine-rich receptor-like protein kinase 36 OS=Arabidopsis thaliana OX=3702 GN=CRK36 PE=1 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 1.8e-24 Identity = 52/79 (65.82%), Postives = 63/79 (79.75%), Query Frame = 0
BLAST of CsGy1G011100 vs. Swiss-Prot
Match: sp|Q9C5S8|CRK5_ARATH (Cysteine-rich receptor-like protein kinase 5 OS=Arabidopsis thaliana OX=3702 GN=CRK5 PE=1 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.1e-23 Identity = 50/79 (63.29%), Postives = 63/79 (79.75%), Query Frame = 0
BLAST of CsGy1G011100 vs. TrEMBL
Match: tr|A0A0A0LX67|A0A0A0LX67_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G065420 PE=4 SV=1) HSP 1 Score: 156.4 bits (394), Expect = 2.8e-35 Identity = 77/79 (97.47%), Postives = 78/79 (98.73%), Query Frame = 0
BLAST of CsGy1G011100 vs. TrEMBL
Match: tr|A0A1S4DSD0|A0A1S4DSD0_CUCME (cysteine-rich receptor-like protein kinase 28 OS=Cucumis melo OX=3656 GN=LOC103489199 PE=4 SV=1) HSP 1 Score: 147.5 bits (371), Expect = 1.3e-32 Identity = 70/79 (88.61%), Postives = 75/79 (94.94%), Query Frame = 0
BLAST of CsGy1G011100 vs. TrEMBL
Match: tr|A0A1S4DSC0|A0A1S4DSC0_CUCME (uncharacterized protein LOC103489206 OS=Cucumis melo OX=3656 GN=LOC103489206 PE=4 SV=1) HSP 1 Score: 136.3 bits (342), Expect = 3.0e-29 Identity = 66/77 (85.71%), Postives = 73/77 (94.81%), Query Frame = 0
BLAST of CsGy1G011100 vs. TrEMBL
Match: tr|A0A0A0LRP0|A0A0A0LRP0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G064870 PE=4 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 3.1e-26 Identity = 60/73 (82.19%), Postives = 66/73 (90.41%), Query Frame = 0
BLAST of CsGy1G011100 vs. TrEMBL
Match: tr|A0A1S3B4F4|A0A1S3B4F4_CUCME (cysteine-rich receptor-like protein kinase 29 OS=Cucumis melo OX=3656 GN=LOC103485643 PE=4 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 5.3e-26 Identity = 58/73 (79.45%), Postives = 67/73 (91.78%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |