CsGy1G009310 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTTAGTTTCACAAGTTGGTGCAATTTTCCACTTTATGAAACAGATTTTGGTTGGGGAAAACCAACGTGGGCCTGTACTCCTGGGCGGCGGTACAAGAACGTGGTGCTTTTTGTTAACACTAGCGACGGTAAAGGAATCGAAGCATGGGTGAATTTGGAGGAAAATGATATGGCGCTCTTTGAAAATGATTCTGAACTTCTTTCCTTCACGTCATAA ATGTTTAGTTTCACAAGTTGGTGCAATTTTCCACTTTATGAAACAGATTTTGGTTGGGGAAAACCAACGTGGGCCTGTACTCCTGGGCGGCGGTACAAGAACGTGGTGCTTTTTGTTAACACTAGCGACGGTAAAGGAATCGAAGCATGGGTGAATTTGGAGGAAAATGATATGGCGCTCTTTGAAAATGATTCTGAACTTCTTTCCTTCACGTCATAA ATGTTTAGTTTCACAAGTTGGTGCAATTTTCCACTTTATGAAACAGATTTTGGTTGGGGAAAACCAACGTGGGCCTGTACTCCTGGGCGGCGGTACAAGAACGTGGTGCTTTTTGTTAACACTAGCGACGGTAAAGGAATCGAAGCATGGGTGAATTTGGAGGAAAATGATATGGCGCTCTTTGAAAATGATTCTGAACTTCTTTCCTTCACGTCATAA MFSFTSWCNFPLYETDFGWGKPTWACTPGRRYKNVVLFVNTSDGKGIEAWVNLEENDMALFENDSELLSFTS
BLAST of CsGy1G009310 vs. NCBI nr
Match: KGN64383.1 (hypothetical protein Csa_1G050220 [Cucumis sativus]) HSP 1 Score: 161.0 bits (406), Expect = 1.5e-36 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of CsGy1G009310 vs. NCBI nr
Match: XP_008446186.1 (PREDICTED: vinorine synthase-like [Cucumis melo] >ADN33961.1 anthranilate N-benzoyltransferase [Cucumis melo subsp. melo]) HSP 1 Score: 149.4 bits (376), Expect = 4.5e-33 Identity = 66/72 (91.67%), Postives = 68/72 (94.44%), Query Frame = 0
BLAST of CsGy1G009310 vs. NCBI nr
Match: KGN64382.1 (hypothetical protein Csa_1G050210 [Cucumis sativus]) HSP 1 Score: 145.2 bits (365), Expect = 8.6e-32 Identity = 64/72 (88.89%), Postives = 67/72 (93.06%), Query Frame = 0
BLAST of CsGy1G009310 vs. NCBI nr
Match: XP_011660357.1 (PREDICTED: LOW QUALITY PROTEIN: vinorine synthase-like [Cucumis sativus]) HSP 1 Score: 144.1 bits (362), Expect = 1.9e-31 Identity = 63/71 (88.73%), Postives = 66/71 (92.96%), Query Frame = 0
BLAST of CsGy1G009310 vs. NCBI nr
Match: XP_008439396.2 (PREDICTED: LOW QUALITY PROTEIN: vinorine synthase-like [Cucumis melo]) HSP 1 Score: 143.7 bits (361), Expect = 2.5e-31 Identity = 63/72 (87.50%), Postives = 66/72 (91.67%), Query Frame = 0
BLAST of CsGy1G009310 vs. TAIR10
Match: AT1G24430.1 (HXXXD-type acyl-transferase family protein) HSP 1 Score: 102.4 bits (254), Expect = 1.2e-22 Identity = 42/71 (59.15%), Postives = 53/71 (74.65%), Query Frame = 0
BLAST of CsGy1G009310 vs. TAIR10
Match: AT3G26040.1 (HXXXD-type acyl-transferase family protein) HSP 1 Score: 92.0 bits (227), Expect = 1.6e-19 Identity = 41/71 (57.75%), Postives = 48/71 (67.61%), Query Frame = 0
BLAST of CsGy1G009310 vs. TAIR10
Match: AT1G24420.1 (HXXXD-type acyl-transferase family protein) HSP 1 Score: 84.0 bits (206), Expect = 4.3e-17 Identity = 36/68 (52.94%), Postives = 45/68 (66.18%), Query Frame = 0
BLAST of CsGy1G009310 vs. TAIR10
Match: AT5G47950.1 (HXXXD-type acyl-transferase family protein) HSP 1 Score: 76.6 bits (187), Expect = 6.8e-15 Identity = 35/75 (46.67%), Postives = 47/75 (62.67%), Query Frame = 0
BLAST of CsGy1G009310 vs. TAIR10
Match: AT3G30280.1 (HXXXD-type acyl-transferase family protein) HSP 1 Score: 73.9 bits (180), Expect = 4.4e-14 Identity = 32/72 (44.44%), Postives = 46/72 (63.89%), Query Frame = 0
BLAST of CsGy1G009310 vs. Swiss-Prot
Match: sp|Q6TXD2|5MAT2_SALSN (Pelargonidin 3-O-(6-caffeoylglucoside) 5-O-(6-O-malonylglucoside) 4'''-malonyltransferase OS=Salvia splendens OX=180675 PE=1 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 9.4e-14 Identity = 35/71 (49.30%), Postives = 44/71 (61.97%), Query Frame = 0
BLAST of CsGy1G009310 vs. Swiss-Prot
Match: sp|Q9FI40|BAHD1_ARATH (BAHD acyltransferase At5g47980 OS=Arabidopsis thaliana OX=3702 GN=BAHD1 PE=2 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.4e-12 Identity = 33/77 (42.86%), Postives = 46/77 (59.74%), Query Frame = 0
BLAST of CsGy1G009310 vs. Swiss-Prot
Match: sp|Q70PR7|VINSY_RAUSE (Vinorine synthase OS=Rauvolfia serpentina OX=4060 GN=ACT PE=1 SV=2) HSP 1 Score: 71.2 bits (173), Expect = 5.1e-12 Identity = 32/69 (46.38%), Postives = 43/69 (62.32%), Query Frame = 0
BLAST of CsGy1G009310 vs. Swiss-Prot
Match: sp|Q9ZTK5|DAT_CATRO (Deacetylvindoline O-acetyltransferase OS=Catharanthus roseus OX=4058 GN=DAT PE=1 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 6.7e-12 Identity = 32/69 (46.38%), Postives = 41/69 (59.42%), Query Frame = 0
BLAST of CsGy1G009310 vs. Swiss-Prot
Match: sp|O23393|BIA1_ARATH (BAHD acyltransferase BIA1 OS=Arabidopsis thaliana OX=3702 GN=BIA1 PE=2 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 7.4e-11 Identity = 29/72 (40.28%), Postives = 45/72 (62.50%), Query Frame = 0
BLAST of CsGy1G009310 vs. TrEMBL
Match: tr|A0A0A0LRG4|A0A0A0LRG4_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G050220 PE=4 SV=1) HSP 1 Score: 161.0 bits (406), Expect = 1.0e-36 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of CsGy1G009310 vs. TrEMBL
Match: tr|A0A1S3BF49|A0A1S3BF49_CUCME (vinorine synthase-like OS=Cucumis melo OX=3656 GN=LOC103488987 PE=4 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 3.0e-33 Identity = 66/72 (91.67%), Postives = 68/72 (94.44%), Query Frame = 0
BLAST of CsGy1G009310 vs. TrEMBL
Match: tr|E5GBW2|E5GBW2_CUCME (Anthranilate N-benzoyltransferase OS=Cucumis melo subsp. melo OX=412675 PE=4 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 3.0e-33 Identity = 66/72 (91.67%), Postives = 68/72 (94.44%), Query Frame = 0
BLAST of CsGy1G009310 vs. TrEMBL
Match: tr|A0A0A0LUA9|A0A0A0LUA9_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G050210 PE=4 SV=1) HSP 1 Score: 145.2 bits (365), Expect = 5.7e-32 Identity = 64/72 (88.89%), Postives = 67/72 (93.06%), Query Frame = 0
BLAST of CsGy1G009310 vs. TrEMBL
Match: tr|A0A1S3AYP7|A0A1S3AYP7_CUCME (LOW QUALITY PROTEIN: vinorine synthase-like OS=Cucumis melo OX=3656 GN=LOC103484210 PE=4 SV=1) HSP 1 Score: 143.7 bits (361), Expect = 1.6e-31 Identity = 63/72 (87.50%), Postives = 66/72 (91.67%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |