CsGy1G009060 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGATTGCCGTGGTTGAGACTACAGCTTTTGCTCAGATTTTGCATAGCTTTGATTGGGAGCTTCCAAGTGGGATTGAAGTAAAGGATTTAGATATGACTGAAGTTGTTGGTATCACAATGCATAGAAAAGCTCACTTGGAGGTTGTAGCAAAGCCCTACTTTGGCTCATCCATCTCAAATTAA ATGGGGATTGCCGTGGTTGAGACTACAGCTTTTGCTCAGATTTTGCATAGCTTTGATTGGGAGCTTCCAAGTGGGATTGAAGTAAAGGATTTAGATATGACTGAAGTTGTTGGTATCACAATGCATAGAAAAGCTCACTTGGAGGTTGTAGCAAAGCCCTACTTTGGCTCATCCATCTCAAATTAA ATGGGGATTGCCGTGGTTGAGACTACAGCTTTTGCTCAGATTTTGCATAGCTTTGATTGGGAGCTTCCAAGTGGGATTGAAGTAAAGGATTTAGATATGACTGAAGTTGTTGGTATCACAATGCATAGAAAAGCTCACTTGGAGGTTGTAGCAAAGCCCTACTTTGGCTCATCCATCTCAAATTAA MGIAVVETTAFAQILHSFDWELPSGIEVKDLDMTEVVGITMHRKAHLEVVAKPYFGSSISN
BLAST of CsGy1G009060 vs. NCBI nr
Match: XP_016900144.1 (PREDICTED: cytochrome P450 71A1-like [Cucumis melo]) HSP 1 Score: 112.5 bits (280), Expect = 5.2e-22 Identity = 53/61 (86.89%), Postives = 59/61 (96.72%), Query Frame = 0
BLAST of CsGy1G009060 vs. NCBI nr
Match: XP_008462004.1 (PREDICTED: cytochrome P450 71A1-like [Cucumis melo]) HSP 1 Score: 107.8 bits (268), Expect = 1.3e-20 Identity = 51/61 (83.61%), Postives = 58/61 (95.08%), Query Frame = 0
BLAST of CsGy1G009060 vs. NCBI nr
Match: XP_004152500.1 (PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]) HSP 1 Score: 104.0 bits (258), Expect = 1.9e-19 Identity = 49/61 (80.33%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of CsGy1G009060 vs. NCBI nr
Match: XP_011651873.1 (PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]) HSP 1 Score: 103.2 bits (256), Expect = 3.2e-19 Identity = 49/61 (80.33%), Postives = 54/61 (88.52%), Query Frame = 0
BLAST of CsGy1G009060 vs. NCBI nr
Match: XP_016900332.1 (PREDICTED: cytochrome P450 71A1-like [Cucumis melo]) HSP 1 Score: 102.1 bits (253), Expect = 7.0e-19 Identity = 48/61 (78.69%), Postives = 52/61 (85.25%), Query Frame = 0
BLAST of CsGy1G009060 vs. TAIR10
Match: AT4G31500.1 (cytochrome P450, family 83, subfamily B, polypeptide 1) HSP 1 Score: 53.5 bits (127), Expect = 5.2e-08 Identity = 23/47 (48.94%), Postives = 33/47 (70.21%), Query Frame = 0
BLAST of CsGy1G009060 vs. TAIR10
Match: AT3G26310.1 (cytochrome P450, family 71, subfamily B, polypeptide 35) HSP 1 Score: 51.6 bits (122), Expect = 2.0e-07 Identity = 23/50 (46.00%), Postives = 35/50 (70.00%), Query Frame = 0
BLAST of CsGy1G009060 vs. TAIR10
Match: AT3G26290.1 (cytochrome P450, family 71, subfamily B, polypeptide 26) HSP 1 Score: 49.7 bits (117), Expect = 7.5e-07 Identity = 23/54 (42.59%), Postives = 35/54 (64.81%), Query Frame = 0
BLAST of CsGy1G009060 vs. TAIR10
Match: AT2G45550.1 (cytochrome P450, family 76, subfamily C, polypeptide 4) HSP 1 Score: 48.9 bits (115), Expect = 1.3e-06 Identity = 19/32 (59.38%), Postives = 26/32 (81.25%), Query Frame = 0
BLAST of CsGy1G009060 vs. TAIR10
Match: AT5G57260.1 (cytochrome P450, family 71, subfamily B, polypeptide 10) HSP 1 Score: 48.9 bits (115), Expect = 1.3e-06 Identity = 23/50 (46.00%), Postives = 32/50 (64.00%), Query Frame = 0
BLAST of CsGy1G009060 vs. Swiss-Prot
Match: sp|A6YIH8|C7D55_HYOMU (Premnaspirodiene oxygenase OS=Hyoscyamus muticus OX=35626 GN=CYP71D55 PE=1 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 2.6e-09 Identity = 26/43 (60.47%), Postives = 36/43 (83.72%), Query Frame = 0
BLAST of CsGy1G009060 vs. Swiss-Prot
Match: sp|O81970|C71A9_SOYBN (Cytochrome P450 71A9 OS=Glycine max OX=3847 GN=CYP71A9 PE=2 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 4.5e-09 Identity = 25/45 (55.56%), Postives = 34/45 (75.56%), Query Frame = 0
BLAST of CsGy1G009060 vs. Swiss-Prot
Match: sp|P37118|C71A2_SOLME (Cytochrome P450 71A2 OS=Solanum melongena OX=4111 GN=CYP71A2 PE=2 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 5.0e-08 Identity = 29/51 (56.86%), Postives = 37/51 (72.55%), Query Frame = 0
BLAST of CsGy1G009060 vs. Swiss-Prot
Match: sp|P93531|C71D7_SOLCH (Cytochrome P450 71D7 OS=Solanum chacoense OX=4108 GN=CYP71D7 PE=3 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 8.5e-08 Identity = 24/43 (55.81%), Postives = 33/43 (76.74%), Query Frame = 0
BLAST of CsGy1G009060 vs. Swiss-Prot
Match: sp|O48957|C99A1_SORBI (Cytochrome P450 CYP99A1 (Fragment) OS=Sorghum bicolor OX=4558 GN=CYP99A1 PE=2 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 2.5e-07 Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 0
BLAST of CsGy1G009060 vs. TrEMBL
Match: tr|A0A1S4DVY3|A0A1S4DVY3_CUCME (cytochrome P450 71A1-like OS=Cucumis melo OX=3656 GN=LOC103488960 PE=3 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 3.4e-22 Identity = 53/61 (86.89%), Postives = 59/61 (96.72%), Query Frame = 0
BLAST of CsGy1G009060 vs. TrEMBL
Match: tr|A0A1S3CHD8|A0A1S3CHD8_CUCME (cytochrome P450 71A1-like OS=Cucumis melo OX=3656 GN=LOC103500475 PE=3 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 8.5e-21 Identity = 51/61 (83.61%), Postives = 58/61 (95.08%), Query Frame = 0
BLAST of CsGy1G009060 vs. TrEMBL
Match: tr|A0A1S4DWG7|A0A1S4DWG7_CUCME (cytochrome P450 71A1-like OS=Cucumis melo OX=3656 GN=LOC103483984 PE=3 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 4.7e-19 Identity = 48/61 (78.69%), Postives = 52/61 (85.25%), Query Frame = 0
BLAST of CsGy1G009060 vs. TrEMBL
Match: tr|A0A1S4DW70|A0A1S4DW70_CUCME (cytochrome P450 71A1-like OS=Cucumis melo OX=3656 GN=LOC107990306 PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 1.3e-16 Identity = 45/55 (81.82%), Postives = 47/55 (85.45%), Query Frame = 0
BLAST of CsGy1G009060 vs. TrEMBL
Match: tr|A0A2G5CGD3|A0A2G5CGD3_AQUCA (Uncharacterized protein OS=Aquilegia coerulea OX=218851 GN=AQUCO_05600026v1 PE=3 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 7.7e-14 Identity = 40/54 (74.07%), Postives = 45/54 (83.33%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |