CsGy1G000370 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGAAGGGAAGGCAAGGAGAGAGTCAGACTCTACACCAGGGGAACAATTCTCGGCTACAAGAGGTCAAAGTCGAACCAGTACCCAAACACTTCTTTACTCCAGATCAAGGGTGTTAATTCTAAGAATGAGGTTTCTTGGTACCAAGGGAAAGGATTGGCATATATTTACAAGGCTAAAGTGAAGAAAAGCGAATGCTATTATCGTTGCATTTGGGACAAAGTAGCAAGACCTCATGGTAACAGTGACATCACTAGAGCAAAGTTCAAGCCTAATCTCCCACCAAAGTCCATGGGTGACAGGGTCAAAGTATTCATGTACCCCAGTAACATTTGA ATGGTGAAGGGAAGGCAAGGAGAGAGTCAGACTCTACACCAGGGGAACAATTCTCGGCTACAAGAGATCAAGGGTGTTAATTCTAAGAATGAGGTTTCTTGGTACCAAGGGAAAGGATTGGCATATATTTACAAGGCTAAAGTGAAGAAAAGCGAATGCTATTATCGTTGCATTTGGGACAAAGTAGCAAGACCTCATGGTAACAGTGACATCACTAGAGCAAAGTTCAAGCCTAATCTCCCACCAAAGTCCATGGGTGACAGGGTCAAAGTATTCATGTACCCCAGTAACATTTGA ATGGTGAAGGGAAGGCAAGGAGAGAGTCAGACTCTACACCAGGGGAACAATTCTCGGCTACAAGAGATCAAGGGTGTTAATTCTAAGAATGAGGTTTCTTGGTACCAAGGGAAAGGATTGGCATATATTTACAAGGCTAAAGTGAAGAAAAGCGAATGCTATTATCGTTGCATTTGGGACAAAGTAGCAAGACCTCATGGTAACAGTGACATCACTAGAGCAAAGTTCAAGCCTAATCTCCCACCAAAGTCCATGGGTGACAGGGTCAAAGTATTCATGTACCCCAGTAACATTTGA MVKGRQGESQTLHQGNNSRLQEIKGVNSKNEVSWYQGKGLAYIYKAKVKKSECYYRCIWDKVARPHGNSDITRAKFKPNLPPKSMGDRVKVFMYPSNI
BLAST of CsGy1G000370 vs. NCBI nr
Match: XP_008463199.1 (PREDICTED: 60S ribosomal protein L35a-1 [Cucumis melo] >XP_011654980.1 PREDICTED: 60S ribosomal protein L35a-1 [Cucumis sativus] >KGN50623.1 hypothetical protein Csa_5G198130 [Cucumis sativus]) HSP 1 Score: 146.7 bits (369), Expect = 4.0e-32 Identity = 76/112 (67.86%), Postives = 84/112 (75.00%), Query Frame = 0
BLAST of CsGy1G000370 vs. NCBI nr
Match: XP_022139205.1 (60S ribosomal protein L35a-1-like [Momordica charantia]) HSP 1 Score: 145.6 bits (366), Expect = 8.9e-32 Identity = 75/112 (66.96%), Postives = 84/112 (75.00%), Query Frame = 0
BLAST of CsGy1G000370 vs. NCBI nr
Match: XP_022156899.1 (60S ribosomal protein L35a-1 [Momordica charantia]) HSP 1 Score: 145.6 bits (366), Expect = 8.9e-32 Identity = 75/112 (66.96%), Postives = 84/112 (75.00%), Query Frame = 0
BLAST of CsGy1G000370 vs. NCBI nr
Match: XP_022957040.1 (60S ribosomal protein L35a-1 [Cucurbita moschata] >XP_022978196.1 60S ribosomal protein L35a-1-like [Cucurbita maxima] >XP_023529930.1 60S ribosomal protein L35a-1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 144.4 bits (363), Expect = 2.0e-31 Identity = 75/112 (66.96%), Postives = 83/112 (74.11%), Query Frame = 0
BLAST of CsGy1G000370 vs. NCBI nr
Match: XP_022996736.1 (60S ribosomal protein L35a-1 [Cucurbita maxima] >XP_022996745.1 60S ribosomal protein L35a-1 [Cucurbita maxima]) HSP 1 Score: 143.7 bits (361), Expect = 3.4e-31 Identity = 75/112 (66.96%), Postives = 83/112 (74.11%), Query Frame = 0
BLAST of CsGy1G000370 vs. TAIR10
Match: AT1G07070.1 (Ribosomal protein L35Ae family protein) HSP 1 Score: 132.1 bits (331), Expect = 1.9e-31 Identity = 66/112 (58.93%), Postives = 78/112 (69.64%), Query Frame = 0
BLAST of CsGy1G000370 vs. TAIR10
Match: AT1G74270.1 (Ribosomal protein L35Ae family protein) HSP 1 Score: 132.1 bits (331), Expect = 1.9e-31 Identity = 66/112 (58.93%), Postives = 79/112 (70.54%), Query Frame = 0
BLAST of CsGy1G000370 vs. TAIR10
Match: AT3G55750.1 (Ribosomal protein L35Ae family protein) HSP 1 Score: 127.9 bits (320), Expect = 3.5e-30 Identity = 64/111 (57.66%), Postives = 78/111 (70.27%), Query Frame = 0
BLAST of CsGy1G000370 vs. TAIR10
Match: AT1G41880.1 (Ribosomal protein L35Ae family protein) HSP 1 Score: 127.5 bits (319), Expect = 4.6e-30 Identity = 64/111 (57.66%), Postives = 78/111 (70.27%), Query Frame = 0
BLAST of CsGy1G000370 vs. Swiss-Prot
Match: sp|Q9LMK0|R35A1_ARATH (60S ribosomal protein L35a-1 OS=Arabidopsis thaliana OX=3702 GN=RPL35AA PE=3 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 3.3e-30 Identity = 66/112 (58.93%), Postives = 78/112 (69.64%), Query Frame = 0
BLAST of CsGy1G000370 vs. Swiss-Prot
Match: sp|Q9C912|R35A3_ARATH (60S ribosomal protein L35a-3 OS=Arabidopsis thaliana OX=3702 GN=RPL35AC PE=3 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 3.3e-30 Identity = 66/112 (58.93%), Postives = 79/112 (70.54%), Query Frame = 0
BLAST of CsGy1G000370 vs. Swiss-Prot
Match: sp|P51422|R35A4_ARATH (60S ribosomal protein L35a-4 OS=Arabidopsis thaliana OX=3702 GN=RPL35AD PE=3 SV=2) HSP 1 Score: 127.9 bits (320), Expect = 6.3e-29 Identity = 64/111 (57.66%), Postives = 78/111 (70.27%), Query Frame = 0
BLAST of CsGy1G000370 vs. Swiss-Prot
Match: sp|Q9FZH0|R35A2_ARATH (60S ribosomal protein L35a-2 OS=Arabidopsis thaliana OX=3702 GN=RPL35AB PE=3 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 8.2e-29 Identity = 64/111 (57.66%), Postives = 78/111 (70.27%), Query Frame = 0
BLAST of CsGy1G000370 vs. Swiss-Prot
Match: sp|Q90YT3|RL35A_ICTPU (60S ribosomal protein L35a OS=Ictalurus punctatus OX=7998 GN=rpl35a PE=3 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 1.0e-15 Identity = 42/91 (46.15%), Postives = 58/91 (63.74%), Query Frame = 0
BLAST of CsGy1G000370 vs. TrEMBL
Match: tr|A0A1S3CIN8|A0A1S3CIN8_CUCME (60S ribosomal protein L35a-1 OS=Cucumis melo OX=3656 GN=LOC103501409 PE=3 SV=1) HSP 1 Score: 146.7 bits (369), Expect = 2.7e-32 Identity = 76/112 (67.86%), Postives = 84/112 (75.00%), Query Frame = 0
BLAST of CsGy1G000370 vs. TrEMBL
Match: tr|A0A0A0KM11|A0A0A0KM11_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G198130 PE=3 SV=1) HSP 1 Score: 146.7 bits (369), Expect = 2.7e-32 Identity = 76/112 (67.86%), Postives = 84/112 (75.00%), Query Frame = 0
BLAST of CsGy1G000370 vs. TrEMBL
Match: tr|A0A2P2JDG1|A0A2P2JDG1_RHIMU (60S ribosomal protein L35aA OS=Rhizophora mucronata OX=61149 PE=3 SV=1) HSP 1 Score: 139.8 bits (351), Expect = 3.2e-30 Identity = 71/112 (63.39%), Postives = 81/112 (72.32%), Query Frame = 0
BLAST of CsGy1G000370 vs. TrEMBL
Match: tr|A0A061FLX4|A0A061FLX4_THECC (Ribosomal protein L35Ae family protein isoform 1 OS=Theobroma cacao OX=3641 GN=TCM_042616 PE=3 SV=1) HSP 1 Score: 139.8 bits (351), Expect = 3.2e-30 Identity = 71/112 (63.39%), Postives = 82/112 (73.21%), Query Frame = 0
BLAST of CsGy1G000370 vs. TrEMBL
Match: tr|A0A067FPF2|A0A067FPF2_CITSI (Uncharacterized protein OS=Citrus sinensis OX=2711 GN=CISIN_1g033755mg PE=3 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 4.2e-30 Identity = 71/112 (63.39%), Postives = 82/112 (73.21%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |