Cp4.1LG19g04680 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTTCCGTTCCTGGAGGTCGAGTGCCGGTTGATCCAAATGACCCACACGTGCGAGATATTGGGGAATGGGCAGTGAAGGAACACAACAAAAGTGGGGATTCACTAAAGTTTCTTGAAGTGGTAAGTGGGTCGAAGCAAATAGTGTCTGGAGAGTTGTACGAGCTTGTGTTGTTGGTTGATGTTGGTGCAAATCGTCATCGAAAATATGAGGCTAAGGTGTTGGAGCAACCATGGGTGGTGCCTCCTCGGAAGCTCGAGTCTTTCCACGTTCTTCTCCTGGAGTGA ATGAGTTCCGTTCCTGGAGGTCGAGTGCCGGTTGATCCAAATGACCCACACGTGCGAGATATTGGGGAATGGGCAGTGAAGGAACACAACAAAAGTGGGGATTCACTAAAGTTTCTTGAAGTGGTAAGTGGGTCGAAGCAAATAGTGTCTGGAGAGTTGTACGAGCTTGTGTTGTTGGTTGATGTTGGTGCAAATCGTCATCGAAAATATGAGGCTAAGGTGTTGGAGCAACCATGGGTGGTGCCTCCTCGGAAGCTCGAGTCTTTCCACGTTCTTCTCCTGGAGTGA ATGAGTTCCGTTCCTGGAGGTCGAGTGCCGGTTGATCCAAATGACCCACACGTGCGAGATATTGGGGAATGGGCAGTGAAGGAACACAACAAAAGTGGGGATTCACTAAAGTTTCTTGAAGTGGTAAGTGGGTCGAAGCAAATAGTGTCTGGAGAGTTGTACGAGCTTGTGTTGTTGGTTGATGTTGGTGCAAATCGTCATCGAAAATATGAGGCTAAGGTGTTGGAGCAACCATGGGTGGTGCCTCCTCGGAAGCTCGAGTCTTTCCACGTTCTTCTCCTGGAGTGA MSSVPGGRVPVDPNDPHVRDIGEWAVKEHNKSGDSLKFLEVVSGSKQIVSGELYELVLLVDVGANRHRKYEAKVLEQPWVVPPRKLESFHVLLLE
BLAST of Cp4.1LG19g04680 vs. Swiss-Prot
Match: CYT8_ORYSJ (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 1.8e-09 Identity = 37/86 (43.02%), Postives = 49/86 (56.98%), Query Frame = 1
BLAST of Cp4.1LG19g04680 vs. Swiss-Prot
Match: CYT7_ORYSJ (Putative cysteine proteinase inhibitor 7 OS=Oryza sativa subsp. japonica GN=Os03g0210100 PE=3 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 3.1e-09 Identity = 36/86 (41.86%), Postives = 46/86 (53.49%), Query Frame = 1
BLAST of Cp4.1LG19g04680 vs. Swiss-Prot
Match: CYT4_ARATH (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana GN=CYS4 PE=3 SV=2) HSP 1 Score: 62.0 bits (149), Expect = 4.1e-09 Identity = 35/89 (39.33%), Postives = 56/89 (62.92%), Query Frame = 1
BLAST of Cp4.1LG19g04680 vs. Swiss-Prot
Match: CYT1_ORYSJ (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 57.8 bits (138), Expect = 7.6e-08 Identity = 35/79 (44.30%), Postives = 51/79 (64.56%), Query Frame = 1
BLAST of Cp4.1LG19g04680 vs. Swiss-Prot
Match: CYT6_ARATH (Cysteine proteinase inhibitor 6 OS=Arabidopsis thaliana GN=CYS6 PE=1 SV=2) HSP 1 Score: 53.9 bits (128), Expect = 1.1e-06 Identity = 29/75 (38.67%), Postives = 45/75 (60.00%), Query Frame = 1
BLAST of Cp4.1LG19g04680 vs. TrEMBL
Match: A0A0K9QH54_SPIOL (Cysteine proteinase inhibitor OS=Spinacia oleracea GN=SOVF_186010 PE=3 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.8e-11 Identity = 44/94 (46.81%), Postives = 57/94 (60.64%), Query Frame = 1
BLAST of Cp4.1LG19g04680 vs. TrEMBL
Match: D7LFL2_ARALL (Cysteine proteinase inhibitor OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_902339 PE=3 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 2.8e-09 Identity = 36/70 (51.43%), Postives = 47/70 (67.14%), Query Frame = 1
BLAST of Cp4.1LG19g04680 vs. TrEMBL
Match: V4N3N5_EUTSA (Cysteine proteinase inhibitor OS=Eutrema salsugineum GN=EUTSA_v10001076mg PE=3 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 3.7e-09 Identity = 39/82 (47.56%), Postives = 52/82 (63.41%), Query Frame = 1
BLAST of Cp4.1LG19g04680 vs. TrEMBL
Match: F6HRK8_VITVI (Cysteine proteinase inhibitor OS=Vitis vinifera GN=VIT_00s0187g00040 PE=3 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 4.8e-09 Identity = 39/80 (48.75%), Postives = 55/80 (68.75%), Query Frame = 1
BLAST of Cp4.1LG19g04680 vs. TrEMBL
Match: A5B2E1_VITVI (Cysteine proteinase inhibitor OS=Vitis vinifera GN=VITISV_013491 PE=3 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 6.3e-09 Identity = 39/80 (48.75%), Postives = 56/80 (70.00%), Query Frame = 1
BLAST of Cp4.1LG19g04680 vs. TAIR10
Match: AT4G16500.1 (AT4G16500.1 Cystatin/monellin superfamily protein) HSP 1 Score: 62.0 bits (149), Expect = 2.3e-10 Identity = 35/89 (39.33%), Postives = 56/89 (62.92%), Query Frame = 1
BLAST of Cp4.1LG19g04680 vs. TAIR10
Match: AT3G12490.2 (AT3G12490.2 cystatin B) HSP 1 Score: 53.9 bits (128), Expect = 6.2e-08 Identity = 29/75 (38.67%), Postives = 45/75 (60.00%), Query Frame = 1
BLAST of Cp4.1LG19g04680 vs. TAIR10
Match: AT5G47550.1 (AT5G47550.1 Cystatin/monellin superfamily protein) HSP 1 Score: 53.9 bits (128), Expect = 6.2e-08 Identity = 36/86 (41.86%), Postives = 49/86 (56.98%), Query Frame = 1
BLAST of Cp4.1LG19g04680 vs. TAIR10
Match: AT5G05110.1 (AT5G05110.1 Cystatin/monellin family protein) HSP 1 Score: 46.6 bits (109), Expect = 9.9e-06 Identity = 25/64 (39.06%), Postives = 42/64 (65.62%), Query Frame = 1
BLAST of Cp4.1LG19g04680 vs. NCBI nr
Match: gi|902155531|gb|KNA05911.1| (hypothetical protein SOVF_186010 [Spinacia oleracea]) HSP 1 Score: 76.6 bits (187), Expect = 2.5e-11 Identity = 44/94 (46.81%), Postives = 57/94 (60.64%), Query Frame = 1
BLAST of Cp4.1LG19g04680 vs. NCBI nr
Match: gi|297826717|ref|XP_002881241.1| (hypothetical protein ARALYDRAFT_902339 [Arabidopsis lyrata subsp. lyrata]) HSP 1 Score: 69.3 bits (168), Expect = 4.1e-09 Identity = 36/70 (51.43%), Postives = 47/70 (67.14%), Query Frame = 1
BLAST of Cp4.1LG19g04680 vs. NCBI nr
Match: gi|567168693|ref|XP_006398453.1| (hypothetical protein EUTSA_v10001076mg [Eutrema salsugineum]) HSP 1 Score: 68.9 bits (167), Expect = 5.3e-09 Identity = 39/82 (47.56%), Postives = 52/82 (63.41%), Query Frame = 1
BLAST of Cp4.1LG19g04680 vs. NCBI nr
Match: gi|359495539|ref|XP_003635016.1| (PREDICTED: cysteine proteinase inhibitor 1-like [Vitis vinifera]) HSP 1 Score: 68.6 bits (166), Expect = 6.9e-09 Identity = 39/80 (48.75%), Postives = 55/80 (68.75%), Query Frame = 1
BLAST of Cp4.1LG19g04680 vs. NCBI nr
Match: gi|568837934|ref|XP_006472972.1| (PREDICTED: multicystatin-like, partial [Citrus sinensis]) HSP 1 Score: 68.6 bits (166), Expect = 6.9e-09 Identity = 36/77 (46.75%), Postives = 51/77 (66.23%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|