Cp4.1LG18g01950 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTCACCGAGTTTCAGCAGGAGATGATGCAGTTGGCTGCAGCGTTGAAAGGAGAGCATATCCTCAGTAGTTACCCTAAACCCTTTGGAAATGATATGACTGTGAAGGAAGGTAGGGGATATATAAGGGAGGCTGTAAAGAGATTCTTTGAGGCGGGGTGTTTAGCTAAGAAAATGGGAGTTAGTGAAGACCAAATTGTCCAAATGAAACCATCTCTTTCTACAAGATCCTCACCAACACCTACACAATTGCCTTAA ATGCTCACCGAGTTTCAGCAGGAGATGATGCAGTTGGCTGCAGCGTTGAAAGGAGAGCATATCCTCAGTAGTTACCCTAAACCCTTTGGAAATGATATGACTGTGAAGGAAGGTAGGGGATATATAAGGGAGGCTGTAAAGAGATTCTTTGAGGCGGGGTGTTTAGCTAAGAAAATGGGAGTTAGTGAAGACCAAATTGTCCAAATGAAACCATCTCTTTCTACAAGATCCTCACCAACACCTACACAATTGCCTTAA ATGCTCACCGAGTTTCAGCAGGAGATGATGCAGTTGGCTGCAGCGTTGAAAGGAGAGCATATCCTCAGTAGTTACCCTAAACCCTTTGGAAATGATATGACTGTGAAGGAAGGTAGGGGATATATAAGGGAGGCTGTAAAGAGATTCTTTGAGGCGGGGTGTTTAGCTAAGAAAATGGGAGTTAGTGAAGACCAAATTGTCCAAATGAAACCATCTCTTTCTACAAGATCCTCACCAACACCTACACAATTGCCTTAA MLTEFQQEMMQLAAALKGEHILSSYPKPFGNDMTVKEGRGYIREAVKRFFEAGCLAKKMGVSEDQIVQMKPSLSTRSSPTPTQLP
BLAST of Cp4.1LG18g01950 vs. Swiss-Prot
Match: NPC2_ARATH (Non-specific phospholipase C2 OS=Arabidopsis thaliana GN=NPC2 PE=2 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 5.2e-16 Identity = 39/76 (51.32%), Postives = 59/76 (77.63%), Query Frame = 1
BLAST of Cp4.1LG18g01950 vs. Swiss-Prot
Match: NPC1_ARATH (Non-specific phospholipase C1 OS=Arabidopsis thaliana GN=NPC1 PE=2 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 2.6e-15 Identity = 41/79 (51.90%), Postives = 58/79 (73.42%), Query Frame = 1
BLAST of Cp4.1LG18g01950 vs. Swiss-Prot
Match: NPC6_ARATH (Non-specific phospholipase C6 OS=Arabidopsis thaliana GN=NPC6 PE=2 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 7.1e-13 Identity = 36/75 (48.00%), Postives = 49/75 (65.33%), Query Frame = 1
BLAST of Cp4.1LG18g01950 vs. Swiss-Prot
Match: NPC3_ARATH (Non-specific phospholipase C3 OS=Arabidopsis thaliana GN=NPC3 PE=2 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 2.6e-07 Identity = 30/78 (38.46%), Postives = 42/78 (53.85%), Query Frame = 1
BLAST of Cp4.1LG18g01950 vs. TrEMBL
Match: A0A0A0LXS4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G629050 PE=4 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 5.1e-26 Identity = 62/84 (73.81%), Postives = 73/84 (86.90%), Query Frame = 1
BLAST of Cp4.1LG18g01950 vs. TrEMBL
Match: B9SJ71_RICCO (Hydrolase, acting on ester bonds, putative OS=Ricinus communis GN=RCOM_1477980 PE=4 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 5.2e-23 Identity = 56/81 (69.14%), Postives = 70/81 (86.42%), Query Frame = 1
BLAST of Cp4.1LG18g01950 vs. TrEMBL
Match: M5X0M9_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa004282mg PE=4 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 8.9e-23 Identity = 57/84 (67.86%), Postives = 68/84 (80.95%), Query Frame = 1
BLAST of Cp4.1LG18g01950 vs. TrEMBL
Match: A0A067L463_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_22783 PE=4 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 8.9e-23 Identity = 55/77 (71.43%), Postives = 65/77 (84.42%), Query Frame = 1
BLAST of Cp4.1LG18g01950 vs. TrEMBL
Match: A0A0D2PYE6_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G133800 PE=4 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 3.4e-22 Identity = 56/84 (66.67%), Postives = 69/84 (82.14%), Query Frame = 1
BLAST of Cp4.1LG18g01950 vs. TAIR10
Match: AT2G26870.1 (AT2G26870.1 non-specific phospholipase C2) HSP 1 Score: 84.7 bits (208), Expect = 2.9e-17 Identity = 39/76 (51.32%), Postives = 59/76 (77.63%), Query Frame = 1
BLAST of Cp4.1LG18g01950 vs. TAIR10
Match: AT1G07230.1 (AT1G07230.1 non-specific phospholipase C1) HSP 1 Score: 82.4 bits (202), Expect = 1.5e-16 Identity = 41/79 (51.90%), Postives = 58/79 (73.42%), Query Frame = 1
BLAST of Cp4.1LG18g01950 vs. TAIR10
Match: AT3G48610.1 (AT3G48610.1 non-specific phospholipase C6) HSP 1 Score: 74.3 bits (181), Expect = 4.0e-14 Identity = 36/75 (48.00%), Postives = 49/75 (65.33%), Query Frame = 1
BLAST of Cp4.1LG18g01950 vs. TAIR10
Match: AT3G03520.1 (AT3G03520.1 non-specific phospholipase C3) HSP 1 Score: 55.8 bits (133), Expect = 1.5e-08 Identity = 30/78 (38.46%), Postives = 42/78 (53.85%), Query Frame = 1
BLAST of Cp4.1LG18g01950 vs. NCBI nr
Match: gi|778663829|ref|XP_004139131.2| (PREDICTED: non-specific phospholipase C2 [Cucumis sativus]) HSP 1 Score: 124.8 bits (312), Expect = 7.3e-26 Identity = 62/84 (73.81%), Postives = 73/84 (86.90%), Query Frame = 1
BLAST of Cp4.1LG18g01950 vs. NCBI nr
Match: gi|659098895|ref|XP_008450341.1| (PREDICTED: non-specific phospholipase C2 [Cucumis melo]) HSP 1 Score: 120.9 bits (302), Expect = 1.1e-24 Identity = 61/84 (72.62%), Postives = 70/84 (83.33%), Query Frame = 1
BLAST of Cp4.1LG18g01950 vs. NCBI nr
Match: gi|223534621|gb|EEF36317.1| (hydrolase, acting on ester bonds, putative [Ricinus communis]) HSP 1 Score: 114.8 bits (286), Expect = 7.5e-23 Identity = 56/81 (69.14%), Postives = 70/81 (86.42%), Query Frame = 1
BLAST of Cp4.1LG18g01950 vs. NCBI nr
Match: gi|1000952136|ref|XP_015578999.1| (PREDICTED: non-specific phospholipase C2 [Ricinus communis]) HSP 1 Score: 114.8 bits (286), Expect = 7.5e-23 Identity = 56/81 (69.14%), Postives = 70/81 (86.42%), Query Frame = 1
BLAST of Cp4.1LG18g01950 vs. NCBI nr
Match: gi|802558919|ref|XP_012065897.1| (PREDICTED: non-specific phospholipase C2 [Jatropha curcas]) HSP 1 Score: 114.0 bits (284), Expect = 1.3e-22 Identity = 55/77 (71.43%), Postives = 65/77 (84.42%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|