Cp4.1LG18g01850 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCTTTTGGAAGTGGCCGAAGGATGTGTCCTGGAATCTCGTTTGCCCTTCAACTTATACATTTTGCTCTTGCAAGTCTACTTCATGAATTTGAAATTGGTAGGCCATCAGAAGAATTACTTACTATGGAAGAGGGATTTGGATTAACTCTTCCACGAAAAACTCCATTGGAAGTTGTTTTACGTCCACGCCTTTCTAATGAAGTTTACGAATAA ATGCCTTTTGGAAGTGGCCGAAGGATGTGTCCTGGAATCTCGTTTGCCCTTCAACTTATACATTTTGCTCTTGCAAGTCTACTTCATGAATTTGAAATTGGTAGGCCATCAGAAGAATTACTTACTATGGAAGAGGGATTTGGATTAACTCTTCCACGAAAAACTCCATTGGAAGTTGTTTTACGTCCACGCCTTTCTAATGAAGTTTACGAATAA ATGCCTTTTGGAAGTGGCCGAAGGATGTGTCCTGGAATCTCGTTTGCCCTTCAACTTATACATTTTGCTCTTGCAAGTCTACTTCATGAATTTGAAATTGGTAGGCCATCAGAAGAATTACTTACTATGGAAGAGGGATTTGGATTAACTCTTCCACGAAAAACTCCATTGGAAGTTGTTTTACGTCCACGCCTTTCTAATGAAGTTTACGAATAA MPFGSGRRMCPGISFALQLIHFALASLLHEFEIGRPSEELLTMEEGFGLTLPRKTPLEVVLRPRLSNEVYE
BLAST of Cp4.1LG18g01850 vs. Swiss-Prot
Match: C82A4_SOYBN (Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=2 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 6.1e-18 Identity = 43/71 (60.56%), Postives = 52/71 (73.24%), Query Frame = 1
BLAST of Cp4.1LG18g01850 vs. Swiss-Prot
Match: C82A3_SOYBN (Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 1.7e-15 Identity = 37/71 (52.11%), Postives = 50/71 (70.42%), Query Frame = 1
BLAST of Cp4.1LG18g01850 vs. Swiss-Prot
Match: C82G1_ARATH (Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 2.8e-15 Identity = 37/70 (52.86%), Postives = 51/70 (72.86%), Query Frame = 1
BLAST of Cp4.1LG18g01850 vs. Swiss-Prot
Match: C82A2_SOYBN (Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 6.3e-15 Identity = 38/71 (53.52%), Postives = 47/71 (66.20%), Query Frame = 1
BLAST of Cp4.1LG18g01850 vs. Swiss-Prot
Match: C82C4_ARATH (Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 1.8e-14 Identity = 34/70 (48.57%), Postives = 48/70 (68.57%), Query Frame = 1
BLAST of Cp4.1LG18g01850 vs. TrEMBL
Match: A0A0A0LG04_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G852630 PE=3 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 1.6e-20 Identity = 51/71 (71.83%), Postives = 59/71 (83.10%), Query Frame = 1
BLAST of Cp4.1LG18g01850 vs. TrEMBL
Match: A0A0A0LG08_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G853170 PE=3 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 5.0e-19 Identity = 47/70 (67.14%), Postives = 57/70 (81.43%), Query Frame = 1
BLAST of Cp4.1LG18g01850 vs. TrEMBL
Match: U5GJ73_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0004s15470g PE=3 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 5.0e-19 Identity = 45/71 (63.38%), Postives = 58/71 (81.69%), Query Frame = 1
BLAST of Cp4.1LG18g01850 vs. TrEMBL
Match: V4SE95_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10003959mg PE=3 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 1.6e-17 Identity = 45/70 (64.29%), Postives = 54/70 (77.14%), Query Frame = 1
BLAST of Cp4.1LG18g01850 vs. TrEMBL
Match: A0A067ETL4_CITSI (Uncharacterized protein (Fragment) OS=Citrus sinensis GN=CISIN_1g0450771mg PE=3 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 1.6e-17 Identity = 45/70 (64.29%), Postives = 54/70 (77.14%), Query Frame = 1
BLAST of Cp4.1LG18g01850 vs. TAIR10
Match: AT3G25180.1 (AT3G25180.1 cytochrome P450, family 82, subfamily G, polypeptide 1) HSP 1 Score: 82.0 bits (201), Expect = 1.6e-16 Identity = 37/70 (52.86%), Postives = 51/70 (72.86%), Query Frame = 1
BLAST of Cp4.1LG18g01850 vs. TAIR10
Match: AT4G31940.1 (AT4G31940.1 cytochrome P450, family 82, subfamily C, polypeptide 4) HSP 1 Score: 79.3 bits (194), Expect = 1.0e-15 Identity = 34/70 (48.57%), Postives = 48/70 (68.57%), Query Frame = 1
BLAST of Cp4.1LG18g01850 vs. TAIR10
Match: AT4G31950.1 (AT4G31950.1 cytochrome P450, family 82, subfamily C, polypeptide 3) HSP 1 Score: 79.0 bits (193), Expect = 1.3e-15 Identity = 35/70 (50.00%), Postives = 47/70 (67.14%), Query Frame = 1
BLAST of Cp4.1LG18g01850 vs. TAIR10
Match: AT4G31970.1 (AT4G31970.1 cytochrome P450, family 82, subfamily C, polypeptide 2) HSP 1 Score: 75.1 bits (183), Expect = 1.9e-14 Identity = 33/70 (47.14%), Postives = 46/70 (65.71%), Query Frame = 1
BLAST of Cp4.1LG18g01850 vs. TAIR10
Match: AT2G25160.1 (AT2G25160.1 cytochrome P450, family 82, subfamily F, polypeptide 1) HSP 1 Score: 70.9 bits (172), Expect = 3.7e-13 Identity = 31/70 (44.29%), Postives = 43/70 (61.43%), Query Frame = 1
BLAST of Cp4.1LG18g01850 vs. NCBI nr
Match: gi|778686466|ref|XP_004147803.2| (PREDICTED: cytochrome P450 CYP82D47-like [Cucumis sativus]) HSP 1 Score: 106.3 bits (264), Expect = 2.2e-20 Identity = 51/71 (71.83%), Postives = 59/71 (83.10%), Query Frame = 1
BLAST of Cp4.1LG18g01850 vs. NCBI nr
Match: gi|659129635|ref|XP_008464765.1| (PREDICTED: cytochrome P450 CYP82D47-like [Cucumis melo]) HSP 1 Score: 105.1 bits (261), Expect = 5.0e-20 Identity = 51/71 (71.83%), Postives = 57/71 (80.28%), Query Frame = 1
BLAST of Cp4.1LG18g01850 vs. NCBI nr
Match: gi|659129645|ref|XP_008464769.1| (PREDICTED: cytochrome P450 CYP82D47-like [Cucumis melo]) HSP 1 Score: 103.2 bits (256), Expect = 1.9e-19 Identity = 49/70 (70.00%), Postives = 57/70 (81.43%), Query Frame = 1
BLAST of Cp4.1LG18g01850 vs. NCBI nr
Match: gi|449460173|ref|XP_004147820.1| (PREDICTED: cytochrome P450 CYP82D47-like [Cucumis sativus]) HSP 1 Score: 101.3 bits (251), Expect = 7.2e-19 Identity = 47/70 (67.14%), Postives = 57/70 (81.43%), Query Frame = 1
BLAST of Cp4.1LG18g01850 vs. NCBI nr
Match: gi|566166707|ref|XP_006384482.1| (hypothetical protein POPTR_0004s15470g [Populus trichocarpa]) HSP 1 Score: 101.3 bits (251), Expect = 7.2e-19 Identity = 45/71 (63.38%), Postives = 58/71 (81.69%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |