Cp4.1LG17g00860 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGACTGTGAACAAGTTGGTGTCCAACAGACCTGTCGTGGTGTTCAGCAAGAACAGTTGCTGTATGAGCCACACTATCAAGTCACTCTTGTGCGACTTTGGAGTTAACCCAACGGTGTACGAGCTTGATGAGCTCCCGGGAGGGAAAGAAATCGAGCAAGCTCTCATTCGGATTGGTTGCAATCCTGCGGTGCCTGCAGTGTTCATCGGCGATCAACTGGTCGGTGGCGCGAATGAAGTGATGAGCCTTCATCTTAAGCGGAACTTGATCCCCATGCTTAGAAGGGCTGGTGCTTTGTGGGTTTAG ATGGAGACTGTGAACAAGTTGGTGTCCAACAGACCTGTCGTGGTGTTCAGCAAGAACAGTTGCTGTATGAGCCACACTATCAAGTCACTCTTGTGCGACTTTGGAGTTAACCCAACGGTGTACGAGCTTGATGAGCTCCCGGGAGGGAAAGAAATCGAGCAAGCTCTCATTCGGATTGGTTGCAATCCTGCGGTGCCTGCAGTGTTCATCGGCGATCAACTGGTCGGTGGCGCGAATGAAGTGATGAGCCTTCATCTTAAGCGGAACTTGATCCCCATGCTTAGAAGGGCTGGTGCTTTGTGGGTTTAG ATGGAGACTGTGAACAAGTTGGTGTCCAACAGACCTGTCGTGGTGTTCAGCAAGAACAGTTGCTGTATGAGCCACACTATCAAGTCACTCTTGTGCGACTTTGGAGTTAACCCAACGGTGTACGAGCTTGATGAGCTCCCGGGAGGGAAAGAAATCGAGCAAGCTCTCATTCGGATTGGTTGCAATCCTGCGGTGCCTGCAGTGTTCATCGGCGATCAACTGGTCGGTGGCGCGAATGAAGTGATGAGCCTTCATCTTAAGCGGAACTTGATCCCCATGCTTAGAAGGGCTGGTGCTTTGTGGGTTTAG METVNKLVSNRPVVVFSKNSCCMSHTIKSLLCDFGVNPTVYELDELPGGKEIEQALIRIGCNPAVPAVFIGDQLVGGANEVMSLHLKRNLIPMLRRAGALWV
BLAST of Cp4.1LG17g00860 vs. Swiss-Prot
Match: GRXS2_ARATH (Monothiol glutaredoxin-S2 OS=Arabidopsis thaliana GN=GRXS2 PE=3 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 5.6e-41 Identity = 75/102 (73.53%), Postives = 90/102 (88.24%), Query Frame = 1
BLAST of Cp4.1LG17g00860 vs. Swiss-Prot
Match: GRXS5_ARATH (Monothiol glutaredoxin-S5 OS=Arabidopsis thaliana GN=GRXS5 PE=3 SV=1) HSP 1 Score: 162.5 bits (410), Expect = 2.4e-39 Identity = 72/102 (70.59%), Postives = 89/102 (87.25%), Query Frame = 1
BLAST of Cp4.1LG17g00860 vs. Swiss-Prot
Match: GRXS4_ARATH (Monothiol glutaredoxin-S4 OS=Arabidopsis thaliana GN=GRXS4 PE=3 SV=1) HSP 1 Score: 161.4 bits (407), Expect = 5.3e-39 Identity = 71/102 (69.61%), Postives = 88/102 (86.27%), Query Frame = 1
BLAST of Cp4.1LG17g00860 vs. Swiss-Prot
Match: GRXS3_ARATH (Monothiol glutaredoxin-S3 OS=Arabidopsis thaliana GN=GRXS3 PE=3 SV=1) HSP 1 Score: 160.6 bits (405), Expect = 9.0e-39 Identity = 71/102 (69.61%), Postives = 87/102 (85.29%), Query Frame = 1
BLAST of Cp4.1LG17g00860 vs. Swiss-Prot
Match: GRXS7_ARATH (Monothiol glutaredoxin-S7 OS=Arabidopsis thaliana GN=GRXS7 PE=3 SV=2) HSP 1 Score: 158.3 bits (399), Expect = 4.5e-38 Identity = 71/102 (69.61%), Postives = 86/102 (84.31%), Query Frame = 1
BLAST of Cp4.1LG17g00860 vs. TrEMBL
Match: U3RJA0_CUCSA (Glutaredoxin OS=Cucumis sativus GN=GRX3 PE=2 SV=1) HSP 1 Score: 198.4 bits (503), Expect = 4.3e-48 Identity = 94/102 (92.16%), Postives = 100/102 (98.04%), Query Frame = 1
BLAST of Cp4.1LG17g00860 vs. TrEMBL
Match: A0A0S3R9B9_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.01G525700 PE=4 SV=1) HSP 1 Score: 172.2 bits (435), Expect = 3.3e-40 Identity = 77/102 (75.49%), Postives = 94/102 (92.16%), Query Frame = 1
BLAST of Cp4.1LG17g00860 vs. TrEMBL
Match: A0A0L9TSM9_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan01g309600 PE=4 SV=1) HSP 1 Score: 172.2 bits (435), Expect = 3.3e-40 Identity = 77/102 (75.49%), Postives = 94/102 (92.16%), Query Frame = 1
BLAST of Cp4.1LG17g00860 vs. TrEMBL
Match: I1MRF6_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_17G023900 PE=4 SV=1) HSP 1 Score: 172.2 bits (435), Expect = 3.3e-40 Identity = 78/102 (76.47%), Postives = 93/102 (91.18%), Query Frame = 1
BLAST of Cp4.1LG17g00860 vs. TrEMBL
Match: A0A0B2P756_GLYSO (Monothiol glutaredoxin-S2 OS=Glycine soja GN=glysoja_004410 PE=4 SV=1) HSP 1 Score: 172.2 bits (435), Expect = 3.3e-40 Identity = 78/102 (76.47%), Postives = 93/102 (91.18%), Query Frame = 1
BLAST of Cp4.1LG17g00860 vs. TAIR10
Match: AT5G18600.1 (AT5G18600.1 Thioredoxin superfamily protein) HSP 1 Score: 167.9 bits (424), Expect = 3.2e-42 Identity = 75/102 (73.53%), Postives = 90/102 (88.24%), Query Frame = 1
BLAST of Cp4.1LG17g00860 vs. TAIR10
Match: AT4G15690.1 (AT4G15690.1 Thioredoxin superfamily protein) HSP 1 Score: 162.5 bits (410), Expect = 1.3e-40 Identity = 72/102 (70.59%), Postives = 89/102 (87.25%), Query Frame = 1
BLAST of Cp4.1LG17g00860 vs. TAIR10
Match: AT4G15680.1 (AT4G15680.1 Thioredoxin superfamily protein) HSP 1 Score: 161.4 bits (407), Expect = 3.0e-40 Identity = 71/102 (69.61%), Postives = 88/102 (86.27%), Query Frame = 1
BLAST of Cp4.1LG17g00860 vs. TAIR10
Match: AT4G15700.1 (AT4G15700.1 Thioredoxin superfamily protein) HSP 1 Score: 160.6 bits (405), Expect = 5.1e-40 Identity = 71/102 (69.61%), Postives = 87/102 (85.29%), Query Frame = 1
BLAST of Cp4.1LG17g00860 vs. TAIR10
Match: AT4G15670.1 (AT4G15670.1 Thioredoxin superfamily protein) HSP 1 Score: 158.3 bits (399), Expect = 2.5e-39 Identity = 71/102 (69.61%), Postives = 86/102 (84.31%), Query Frame = 1
BLAST of Cp4.1LG17g00860 vs. NCBI nr
Match: gi|566006172|ref|NP_001274383.1| (monothiol glutaredoxin-S2-like [Cucumis sativus]) HSP 1 Score: 198.4 bits (503), Expect = 6.2e-48 Identity = 94/102 (92.16%), Postives = 100/102 (98.04%), Query Frame = 1
BLAST of Cp4.1LG17g00860 vs. NCBI nr
Match: gi|657996709|ref|XP_008390722.1| (PREDICTED: monothiol glutaredoxin-S2 [Malus domestica]) HSP 1 Score: 174.9 bits (442), Expect = 7.4e-41 Identity = 80/102 (78.43%), Postives = 91/102 (89.22%), Query Frame = 1
BLAST of Cp4.1LG17g00860 vs. NCBI nr
Match: gi|951003839|ref|XP_014507713.1| (PREDICTED: monothiol glutaredoxin-S2-like [Vigna radiata var. radiata]) HSP 1 Score: 174.5 bits (441), Expect = 9.6e-41 Identity = 79/102 (77.45%), Postives = 94/102 (92.16%), Query Frame = 1
BLAST of Cp4.1LG17g00860 vs. NCBI nr
Match: gi|920689557|gb|KOM33540.1| (hypothetical protein LR48_Vigan01g309600 [Vigna angularis]) HSP 1 Score: 172.2 bits (435), Expect = 4.8e-40 Identity = 77/102 (75.49%), Postives = 94/102 (92.16%), Query Frame = 1
BLAST of Cp4.1LG17g00860 vs. NCBI nr
Match: gi|694322177|ref|XP_009352227.1| (PREDICTED: monothiol glutaredoxin-S2 [Pyrus x bretschneideri]) HSP 1 Score: 172.2 bits (435), Expect = 4.8e-40 Identity = 79/102 (77.45%), Postives = 90/102 (88.24%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |