Cp4.1LG16g06750 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGATTGTAACCCTTTCTCGTCCCAACAAAATGGTTGTGGCCTTAGCATTAGCCTTATTCGCCGTGTTCATGGGGAACTCATCGGCTCATCTCTCTCCCGATTTCTACTACAAGAGCTGCCCTAAGCTCCTTAGCACTGTCCAAGCTGGTGTTCGGTCTGCCGTGGCTAAGGAACCTCGCATGGGCGCTTCCCTTCTCCGCCTCCACTTTCATGACTGCTTCGTTAACGTATAA ATGGCGATTGTAACCCTTTCTCGTCCCAACAAAATGGTTGTGGCCTTAGCATTAGCCTTATTCGCCGTGTTCATGGGGAACTCATCGGCTCATCTCTCTCCCGATTTCTACTACAAGAGCTGCCCTAAGCTCCTTAGCACTGTCCAAGCTGGTGTTCGGTCTGCCGTGGCTAAGGAACCTCGCATGGGCGCTTCCCTTCTCCGCCTCCACTTTCATGACTGCTTCGTTAACGTATAA ATGGCGATTGTAACCCTTTCTCGTCCCAACAAAATGGTTGTGGCCTTAGCATTAGCCTTATTCGCCGTGTTCATGGGGAACTCATCGGCTCATCTCTCTCCCGATTTCTACTACAAGAGCTGCCCTAAGCTCCTTAGCACTGTCCAAGCTGGTGTTCGGTCTGCCGTGGCTAAGGAACCTCGCATGGGCGCTTCCCTTCTCCGCCTCCACTTTCATGACTGCTTCGTTAACGTATAA MAIVTLSRPNKMVVALALALFAVFMGNSSAHLSPDFYYKSCPKLLSTVQAGVRSAVAKEPRMGASLLRLHFHDCFVNV
BLAST of Cp4.1LG16g06750 vs. Swiss-Prot
Match: PER4_VITVI (Peroxidase 4 OS=Vitis vinifera GN=GSVIVT00023967001 PE=1 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 1.9e-17 Identity = 42/65 (64.62%), Postives = 54/65 (83.08%), Query Frame = 1
BLAST of Cp4.1LG16g06750 vs. Swiss-Prot
Match: PER70_MAIZE (Peroxidase 70 OS=Zea mays GN=PER70 PE=1 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 7.7e-14 Identity = 40/65 (61.54%), Postives = 50/65 (76.92%), Query Frame = 1
BLAST of Cp4.1LG16g06750 vs. Swiss-Prot
Match: PER1_ARAHY (Cationic peroxidase 1 OS=Arachis hypogaea GN=PNC1 PE=1 SV=2) HSP 1 Score: 77.0 bits (188), Expect = 1.0e-13 Identity = 36/57 (63.16%), Postives = 42/57 (73.68%), Query Frame = 1
BLAST of Cp4.1LG16g06750 vs. Swiss-Prot
Match: PER66_MAIZE (Peroxidase 66 OS=Zea mays GN=PER66 PE=1 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 2.2e-13 Identity = 38/62 (61.29%), Postives = 48/62 (77.42%), Query Frame = 1
BLAST of Cp4.1LG16g06750 vs. Swiss-Prot
Match: PER1_HORVU (Peroxidase 1 OS=Hordeum vulgare PE=2 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 2.2e-13 Identity = 34/60 (56.67%), Postives = 45/60 (75.00%), Query Frame = 1
BLAST of Cp4.1LG16g06750 vs. TrEMBL
Match: A0A0A0KCF1_CUCSA (Peroxidase OS=Cucumis sativus GN=Csa_6G216420 PE=3 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 2.9e-20 Identity = 51/64 (79.69%), Postives = 56/64 (87.50%), Query Frame = 1
BLAST of Cp4.1LG16g06750 vs. TrEMBL
Match: A0A068J7H5_MOMCH (Peroxidase OS=Momordica charantia PE=2 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 5.5e-19 Identity = 56/78 (71.79%), Postives = 62/78 (79.49%), Query Frame = 1
BLAST of Cp4.1LG16g06750 vs. TrEMBL
Match: Q6T1D0_QUESU (Peroxidase OS=Quercus suber GN=POX2 PE=2 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 1.8e-17 Identity = 43/68 (63.24%), Postives = 56/68 (82.35%), Query Frame = 1
BLAST of Cp4.1LG16g06750 vs. TrEMBL
Match: A0A0A0KFL8_CUCSA (Peroxidase OS=Cucumis sativus GN=Csa_6G216410 PE=3 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 5.2e-17 Identity = 43/55 (78.18%), Postives = 50/55 (90.91%), Query Frame = 1
BLAST of Cp4.1LG16g06750 vs. TrEMBL
Match: A0A067DIZ2_CITSI (Peroxidase OS=Citrus sinensis GN=CISIN_1g020615mg PE=3 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 6.7e-17 Identity = 45/68 (66.18%), Postives = 55/68 (80.88%), Query Frame = 1
BLAST of Cp4.1LG16g06750 vs. TAIR10
Match: AT5G05340.1 (AT5G05340.1 Peroxidase superfamily protein) HSP 1 Score: 74.7 bits (182), Expect = 2.8e-14 Identity = 38/72 (52.78%), Postives = 49/72 (68.06%), Query Frame = 1
BLAST of Cp4.1LG16g06750 vs. TAIR10
Match: AT5G58390.1 (AT5G58390.1 Peroxidase superfamily protein) HSP 1 Score: 72.0 bits (175), Expect = 1.8e-13 Identity = 35/66 (53.03%), Postives = 44/66 (66.67%), Query Frame = 1
BLAST of Cp4.1LG16g06750 vs. TAIR10
Match: AT1G14540.1 (AT1G14540.1 Peroxidase superfamily protein) HSP 1 Score: 69.7 bits (169), Expect = 9.0e-13 Identity = 33/66 (50.00%), Postives = 47/66 (71.21%), Query Frame = 1
BLAST of Cp4.1LG16g06750 vs. TAIR10
Match: AT5G58400.1 (AT5G58400.1 Peroxidase superfamily protein) HSP 1 Score: 67.8 bits (164), Expect = 3.4e-12 Identity = 36/64 (56.25%), Postives = 43/64 (67.19%), Query Frame = 1
BLAST of Cp4.1LG16g06750 vs. TAIR10
Match: AT3G50990.1 (AT3G50990.1 Peroxidase superfamily protein) HSP 1 Score: 66.2 bits (160), Expect = 9.9e-12 Identity = 30/51 (58.82%), Postives = 36/51 (70.59%), Query Frame = 1
BLAST of Cp4.1LG16g06750 vs. NCBI nr
Match: gi|659130692|ref|XP_008465298.1| (PREDICTED: peroxidase 4-like [Cucumis melo]) HSP 1 Score: 113.6 bits (283), Expect = 1.5e-22 Identity = 56/77 (72.73%), Postives = 65/77 (84.42%), Query Frame = 1
BLAST of Cp4.1LG16g06750 vs. NCBI nr
Match: gi|659127648|ref|XP_008463814.1| (PREDICTED: peroxidase 4-like [Cucumis melo]) HSP 1 Score: 113.2 bits (282), Expect = 2.0e-22 Identity = 60/78 (76.92%), Postives = 64/78 (82.05%), Query Frame = 1
BLAST of Cp4.1LG16g06750 vs. NCBI nr
Match: gi|700192019|gb|KGN47223.1| (hypothetical protein Csa_6G216420 [Cucumis sativus]) HSP 1 Score: 105.5 bits (262), Expect = 4.2e-20 Identity = 51/64 (79.69%), Postives = 56/64 (87.50%), Query Frame = 1
BLAST of Cp4.1LG16g06750 vs. NCBI nr
Match: gi|449463288|ref|XP_004149366.1| (PREDICTED: peroxidase 4-like [Cucumis sativus]) HSP 1 Score: 102.8 bits (255), Expect = 2.7e-19 Identity = 49/66 (74.24%), Postives = 57/66 (86.36%), Query Frame = 1
BLAST of Cp4.1LG16g06750 vs. NCBI nr
Match: gi|661349898|gb|AIE12239.1| (peroxide [Momordica charantia]) HSP 1 Score: 101.3 bits (251), Expect = 7.9e-19 Identity = 56/78 (71.79%), Postives = 62/78 (79.49%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|