Cp4.1LG16g01090 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGAACAAATCCTTCCTCTCCATGCTCCTATTGGTCCTCCTCATCTTCTCTTCTTCAGGTAATCAAAGTCTAACCCTACCATCTTTGCCATTTCTTCTTTCTTCCTTTCTTCCTAATATGTGTGTTATTTGCAGAAGAGATGATGGGTCGTGGTGCTGAGGCTCGAATATGCAAGTCCAGGAACCACCACTACCATGGCCTCTGCTTTAGCCACAAGTGCGCTACTCGTTGCCGAAAGGAAGGCTACCTTGGCGGTCATTGTCACCACTTCCCCCGCCATTGCTATTGCACTCACAGTTGTTAA ATGATGAACAAATCCTTCCTCTCCATGCTCCTATTGGTCCTCCTCATCTTCTCTTCTTCAGAAGAGATGATGGGTCGTGGTGCTGAGGCTCGAATATGCAAGTCCAGGAACCACCACTACCATGGCCTCTGCTTTAGCCACAAGTGCGCTACTCGTTGCCGAAAGGAAGGCTACCTTGGCGGTCATTGTCACCACTTCCCCCGCCATTGCTATTGCACTCACAGTTGTTAA ATGATGAACAAATCCTTCCTCTCCATGCTCCTATTGGTCCTCCTCATCTTCTCTTCTTCAGAAGAGATGATGGGTCGTGGTGCTGAGGCTCGAATATGCAAGTCCAGGAACCACCACTACCATGGCCTCTGCTTTAGCCACAAGTGCGCTACTCGTTGCCGAAAGGAAGGCTACCTTGGCGGTCATTGTCACCACTTCCCCCGCCATTGCTATTGCACTCACAGTTGTTAA MMNKSFLSMLLLVLLIFSSSEEMMGRGAEARICKSRNHHYHGLCFSHKCATRCRKEGYLGGHCHHFPRHCYCTHSC
BLAST of Cp4.1LG16g01090 vs. Swiss-Prot
Match: DEF06_ARATH (Defensin-like protein 6 OS=Arabidopsis thaliana GN=PDF2.5 PE=3 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.2e-11 Identity = 35/76 (46.05%), Postives = 46/76 (60.53%), Query Frame = 1
BLAST of Cp4.1LG16g01090 vs. Swiss-Prot
Match: DEF2_CAPAN (Defensin J1-2 OS=Capsicum annuum PE=1 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 1.5e-09 Identity = 31/75 (41.33%), Postives = 47/75 (62.67%), Query Frame = 1
BLAST of Cp4.1LG16g01090 vs. Swiss-Prot
Match: DEF01_ARATH (Defensin-like protein 1 OS=Arabidopsis thaliana GN=PDF2.3 PE=2 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 6.1e-08 Identity = 32/75 (42.67%), Postives = 43/75 (57.33%), Query Frame = 1
BLAST of Cp4.1LG16g01090 vs. Swiss-Prot
Match: DEF_NELNU (Defensin-like protein OS=Nelumbo nucifera PE=3 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 7.5e-06 Identity = 28/72 (38.89%), Postives = 44/72 (61.11%), Query Frame = 1
BLAST of Cp4.1LG16g01090 vs. TrEMBL
Match: A0A0A0LN65_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G340400 PE=3 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 1.0e-17 Identity = 47/77 (61.04%), Postives = 58/77 (75.32%), Query Frame = 1
BLAST of Cp4.1LG16g01090 vs. TrEMBL
Match: W5RNL9_CITLA (Defensin-like protein 2 OS=Citrullus lanatus GN=PDF2.2 PE=2 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 5.6e-16 Identity = 48/78 (61.54%), Postives = 56/78 (71.79%), Query Frame = 1
BLAST of Cp4.1LG16g01090 vs. TrEMBL
Match: Q9FQ14_CITPA (Proteinase inhibitor se60-like protein OS=Citrus paradisi PE=2 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 9.2e-11 Identity = 36/74 (48.65%), Postives = 50/74 (67.57%), Query Frame = 1
BLAST of Cp4.1LG16g01090 vs. TrEMBL
Match: V4SLE8_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10026887mg PE=3 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 9.2e-11 Identity = 36/74 (48.65%), Postives = 50/74 (67.57%), Query Frame = 1
BLAST of Cp4.1LG16g01090 vs. TrEMBL
Match: V4UJZ8_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10026887mg PE=3 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 1.7e-09 Identity = 35/74 (47.30%), Postives = 48/74 (64.86%), Query Frame = 1
BLAST of Cp4.1LG16g01090 vs. TAIR10
Match: AT5G63660.1 (AT5G63660.1 Scorpion toxin-like knottin superfamily protein) HSP 1 Score: 70.1 bits (170), Expect = 6.7e-13 Identity = 35/76 (46.05%), Postives = 46/76 (60.53%), Query Frame = 1
BLAST of Cp4.1LG16g01090 vs. TAIR10
Match: AT2G02130.1 (AT2G02130.1 low-molecular-weight cysteine-rich 68) HSP 1 Score: 57.8 bits (138), Expect = 3.4e-09 Identity = 32/75 (42.67%), Postives = 43/75 (57.33%), Query Frame = 1
BLAST of Cp4.1LG16g01090 vs. NCBI nr
Match: gi|700207128|gb|KGN62247.1| (hypothetical protein Csa_2G340400 [Cucumis sativus]) HSP 1 Score: 97.1 bits (240), Expect = 1.5e-17 Identity = 47/77 (61.04%), Postives = 58/77 (75.32%), Query Frame = 1
BLAST of Cp4.1LG16g01090 vs. NCBI nr
Match: gi|558067066|gb|AHA50468.1| (defensin-like protein 2 [Citrullus lanatus]) HSP 1 Score: 91.3 bits (225), Expect = 8.0e-16 Identity = 48/78 (61.54%), Postives = 56/78 (71.79%), Query Frame = 1
BLAST of Cp4.1LG16g01090 vs. NCBI nr
Match: gi|11596184|gb|AAG38520.1|AF283535_1 (proteinase inhibitor se60-like protein [Citrus x paradisi]) HSP 1 Score: 73.9 bits (180), Expect = 1.3e-10 Identity = 36/74 (48.65%), Postives = 50/74 (67.57%), Query Frame = 1
BLAST of Cp4.1LG16g01090 vs. NCBI nr
Match: gi|567867595|ref|XP_006426420.1| (hypothetical protein CICLE_v10026887mg [Citrus clementina]) HSP 1 Score: 73.9 bits (180), Expect = 1.3e-10 Identity = 36/74 (48.65%), Postives = 50/74 (67.57%), Query Frame = 1
BLAST of Cp4.1LG16g01090 vs. NCBI nr
Match: gi|15242860|ref|NP_201171.1| (defensin-like protein 6 [Arabidopsis thaliana]) HSP 1 Score: 70.1 bits (170), Expect = 1.9e-09 Identity = 35/76 (46.05%), Postives = 46/76 (60.53%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|