Cp4.1LG14g05780 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTTTCTCGGCTCTGTTCCTACTCCATTGGAGCTTCTTCTTCTGGTTTCTTCTTCGGTGGTTGTCGCAGTGCTGAGTTTAGAAATAGTTTCATTCCGCGCAGTTGGGCCATCGGCGGTGTTGGGTTAGTGACAAACATGGCATCTGAAGGCCGCCGACAGTTTCCTCCACAGAAGCAACAAGCTCAGCCTGGCAAAGAGCACGTCATGGACCCAACTCCACAGTTTACCAGCCCAGATTACAGGCCTGCCAATAAGCTTCAGGCACCTTTCTTTTCAATCTAA ATGCTTTCTCGGCTCTGTTCCTACTCCATTGGAGCTTCTTCTTCTGGTTTCTTCTTCGGTGGTTGTCGCAGTGCTGAGTTTAGAAATAGTTTCATTCCGCGCAGTTGGGCCATCGGCGGTGTTGGGTTAGTGACAAACATGGCATCTGAAGGCCGCCGACAGTTTCCTCCACAGAAGCAACAAGCTCAGCCTGGCAAAGAGCACGTCATGGACCCAACTCCACAGTTTACCAGCCCAGATTACAGGCCTGCCAATAAGCTTCAGGCACCTTTCTTTTCAATCTAA ATGCTTTCTCGGCTCTGTTCCTACTCCATTGGAGCTTCTTCTTCTGGTTTCTTCTTCGGTGGTTGTCGCAGTGCTGAGTTTAGAAATAGTTTCATTCCGCGCAGTTGGGCCATCGGCGGTGTTGGGTTAGTGACAAACATGGCATCTGAAGGCCGCCGACAGTTTCCTCCACAGAAGCAACAAGCTCAGCCTGGCAAAGAGCACGTCATGGACCCAACTCCACAGTTTACCAGCCCAGATTACAGGCCTGCCAATAAGCTTCAGGCACCTTTCTTTTCAATCTAA MLSRLCSYSIGASSSGFFFGGCRSAEFRNSFIPRSWAIGGVGLVTNMASEGRRQFPPQKQQAQPGKEHVMDPTPQFTSPDYRPANKLQAPFFSI
BLAST of Cp4.1LG14g05780 vs. Swiss-Prot
Match: GRDH_DAUCA (Glucose and ribitol dehydrogenase OS=Daucus carota GN=CAISE5 PE=2 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 2.8e-10 Identity = 31/42 (73.81%), Postives = 36/42 (85.71%), Query Frame = 1
BLAST of Cp4.1LG14g05780 vs. Swiss-Prot
Match: GRDH2_ARATH (Glucose and ribitol dehydrogenase homolog 2 OS=Arabidopsis thaliana GN=At3g05260 PE=2 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 3.8e-07 Identity = 22/33 (66.67%), Postives = 30/33 (90.91%), Query Frame = 1
BLAST of Cp4.1LG14g05780 vs. Swiss-Prot
Match: GRDH_ORYSJ (Glucose and ribitol dehydrogenase homolog OS=Oryza sativa subsp. japonica GN=Os05g0140800 PE=2 SV=2) HSP 1 Score: 52.4 bits (124), Expect = 3.2e-06 Identity = 22/36 (61.11%), Postives = 27/36 (75.00%), Query Frame = 1
BLAST of Cp4.1LG14g05780 vs. Swiss-Prot
Match: GRDH1_ARATH (Glucose and ribitol dehydrogenase homolog 1 OS=Arabidopsis thaliana GN=At1g54870 PE=2 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 7.1e-06 Identity = 22/31 (70.97%), Postives = 28/31 (90.32%), Query Frame = 1
BLAST of Cp4.1LG14g05780 vs. TrEMBL
Match: A0A0A0L9H4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G176290 PE=4 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 8.4e-14 Identity = 39/47 (82.98%), Postives = 43/47 (91.49%), Query Frame = 1
BLAST of Cp4.1LG14g05780 vs. TrEMBL
Match: M5WC58_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa009407mg PE=4 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 1.0e-11 Identity = 33/42 (78.57%), Postives = 39/42 (92.86%), Query Frame = 1
BLAST of Cp4.1LG14g05780 vs. TrEMBL
Match: V4TAA6_9ROSI (Uncharacterized protein (Fragment) OS=Citrus clementina GN=CICLE_v10003201mg PE=4 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 8.7e-11 Identity = 34/46 (73.91%), Postives = 42/46 (91.30%), Query Frame = 1
BLAST of Cp4.1LG14g05780 vs. TrEMBL
Match: A0A061FA32_THECC (NAD(P)-binding Rossmann-fold superfamily protein OS=Theobroma cacao GN=TCM_026573 PE=4 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.9e-10 Identity = 32/42 (76.19%), Postives = 37/42 (88.10%), Query Frame = 1
BLAST of Cp4.1LG14g05780 vs. TrEMBL
Match: F6HYY9_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_14s0128g00340 PE=4 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 3.3e-10 Identity = 33/46 (71.74%), Postives = 38/46 (82.61%), Query Frame = 1
BLAST of Cp4.1LG14g05780 vs. TAIR10
Match: AT3G05260.1 (AT3G05260.1 NAD(P)-binding Rossmann-fold superfamily protein) HSP 1 Score: 55.5 bits (132), Expect = 2.1e-08 Identity = 22/33 (66.67%), Postives = 30/33 (90.91%), Query Frame = 1
BLAST of Cp4.1LG14g05780 vs. TAIR10
Match: AT1G54870.1 (AT1G54870.1 NAD(P)-binding Rossmann-fold superfamily protein) HSP 1 Score: 51.2 bits (121), Expect = 4.0e-07 Identity = 22/31 (70.97%), Postives = 28/31 (90.32%), Query Frame = 1
BLAST of Cp4.1LG14g05780 vs. NCBI nr
Match: gi|659077245|ref|XP_008439102.1| (PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Cucumis melo]) HSP 1 Score: 89.4 bits (220), Expect = 3.7e-15 Identity = 53/100 (53.00%), Postives = 59/100 (59.00%), Query Frame = 1
BLAST of Cp4.1LG14g05780 vs. NCBI nr
Match: gi|700202149|gb|KGN57282.1| (hypothetical protein Csa_3G176290 [Cucumis sativus]) HSP 1 Score: 84.3 bits (207), Expect = 1.2e-13 Identity = 39/47 (82.98%), Postives = 43/47 (91.49%), Query Frame = 1
BLAST of Cp4.1LG14g05780 vs. NCBI nr
Match: gi|449460806|ref|XP_004148135.1| (PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Cucumis sativus]) HSP 1 Score: 81.3 bits (199), Expect = 1.0e-12 Identity = 36/42 (85.71%), Postives = 40/42 (95.24%), Query Frame = 1
BLAST of Cp4.1LG14g05780 vs. NCBI nr
Match: gi|645222217|ref|XP_008246486.1| (PREDICTED: glucose and ribitol dehydrogenase-like [Prunus mume]) HSP 1 Score: 77.4 bits (189), Expect = 1.5e-11 Identity = 33/42 (78.57%), Postives = 39/42 (92.86%), Query Frame = 1
BLAST of Cp4.1LG14g05780 vs. NCBI nr
Match: gi|694445999|ref|XP_009349395.1| (PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Pyrus x bretschneideri]) HSP 1 Score: 77.4 bits (189), Expect = 1.5e-11 Identity = 34/42 (80.95%), Postives = 39/42 (92.86%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|