Cp4.1LG14g01830 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTATGTCTATGAGCTTTGTCTTTGCTTTGGCTCTTCTTGCCATGGCTTCTGGTGGTTTGTCTCATAAGATTGGCGGCGGTGGCGGCGGAGGTGGCGGCGGGAGTGGTGGTGGTGGTGGTGGTGGTGGTGGGTATTATTTGTATTCACAATTCTATGACCATTCTTGTCCAAGAGCTCAAGAGATAGTGAAGTACATAGTGGGTAAGGCTTTTGCTAAGGATCCTCGCATGGCTGCTTCCTTGCTTAGGCTTCATTTCCATGATTGCTTTGTTAAGGTTCATTTCTAA ATGGCTATGTCTATGAGCTTTGTCTTTGCTTTGGCTCTTCTTGCCATGGCTTCTGGTGGTTTGTCTCATAAGATTGGCGGCGGTGGCGGCGGAGGTGGCGGCGGGAGTGGTGGTGGTGGTGGTGGTGGTGGTGGGTATTATTTGTATTCACAATTCTATGACCATTCTTGTCCAAGAGCTCAAGAGATAGTGAAGTACATAGTGGGTAAGGCTTTTGCTAAGGATCCTCGCATGGCTGCTTCCTTGCTTAGGCTTCATTTCCATGATTGCTTTGTTAAGGTTCATTTCTAA ATGGCTATGTCTATGAGCTTTGTCTTTGCTTTGGCTCTTCTTGCCATGGCTTCTGGTGGTTTGTCTCATAAGATTGGCGGCGGTGGCGGCGGAGGTGGCGGCGGGAGTGGTGGTGGTGGTGGTGGTGGTGGTGGGTATTATTTGTATTCACAATTCTATGACCATTCTTGTCCAAGAGCTCAAGAGATAGTGAAGTACATAGTGGGTAAGGCTTTTGCTAAGGATCCTCGCATGGCTGCTTCCTTGCTTAGGCTTCATTTCCATGATTGCTTTGTTAAGGTTCATTTCTAA MAMSMSFVFALALLAMASGGLSHKIGGGGGGGGGGSGGGGGGGGGYYLYSQFYDHSCPRAQEIVKYIVGKAFAKDPRMAASLLRLHFHDCFVKVHF
BLAST of Cp4.1LG14g01830 vs. Swiss-Prot
Match: PER72_ARATH (Peroxidase 72 OS=Arabidopsis thaliana GN=PER72 PE=1 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 7.2e-14 Identity = 49/94 (52.13%), Postives = 58/94 (61.70%), Query Frame = 1
BLAST of Cp4.1LG14g01830 vs. Swiss-Prot
Match: PER14_ARATH (Peroxidase 14 OS=Arabidopsis thaliana GN=PER14 PE=3 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 2.0e-11 Identity = 32/52 (61.54%), Postives = 40/52 (76.92%), Query Frame = 1
BLAST of Cp4.1LG14g01830 vs. Swiss-Prot
Match: PER49_ARATH (Peroxidase 49 OS=Arabidopsis thaliana GN=PER49 PE=2 SV=2) HSP 1 Score: 68.6 bits (166), Expect = 4.4e-11 Identity = 30/49 (61.22%), Postives = 38/49 (77.55%), Query Frame = 1
BLAST of Cp4.1LG14g01830 vs. Swiss-Prot
Match: PER36_ARATH (Peroxidase 36 OS=Arabidopsis thaliana GN=PER36 PE=2 SV=2) HSP 1 Score: 68.6 bits (166), Expect = 4.4e-11 Identity = 30/45 (66.67%), Postives = 35/45 (77.78%), Query Frame = 1
BLAST of Cp4.1LG14g01830 vs. Swiss-Prot
Match: PER15_ARATH (Peroxidase 15 OS=Arabidopsis thaliana GN=PER15 PE=2 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 9.7e-11 Identity = 32/52 (61.54%), Postives = 40/52 (76.92%), Query Frame = 1
BLAST of Cp4.1LG14g01830 vs. TrEMBL
Match: A0A0A0KZH0_CUCSA (Peroxidase OS=Cucumis sativus GN=Csa_4G045010 PE=3 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.5e-21 Identity = 64/93 (68.82%), Postives = 68/93 (73.12%), Query Frame = 1
BLAST of Cp4.1LG14g01830 vs. TrEMBL
Match: A0A0B0NAC3_GOSAR (Peroxidase OS=Gossypium arboreum GN=F383_11996 PE=3 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 7.5e-18 Identity = 57/93 (61.29%), Postives = 63/93 (67.74%), Query Frame = 1
BLAST of Cp4.1LG14g01830 vs. TrEMBL
Match: A0A0D2PCA4_GOSRA (Peroxidase OS=Gossypium raimondii GN=B456_007G199700 PE=3 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 4.9e-17 Identity = 56/93 (60.22%), Postives = 62/93 (66.67%), Query Frame = 1
BLAST of Cp4.1LG14g01830 vs. TrEMBL
Match: A0A0D2T9Z5_GOSRA (Peroxidase OS=Gossypium raimondii GN=B456_007G065200 PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 7.0e-16 Identity = 41/49 (83.67%), Postives = 44/49 (89.80%), Query Frame = 1
BLAST of Cp4.1LG14g01830 vs. TrEMBL
Match: F6GWS4_VITVI (Peroxidase OS=Vitis vinifera GN=VIT_04s0023g02570 PE=3 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 2.0e-15 Identity = 50/93 (53.76%), Postives = 60/93 (64.52%), Query Frame = 1
BLAST of Cp4.1LG14g01830 vs. TAIR10
Match: AT5G66390.1 (AT5G66390.1 Peroxidase superfamily protein) HSP 1 Score: 77.8 bits (190), Expect = 4.1e-15 Identity = 49/94 (52.13%), Postives = 58/94 (61.70%), Query Frame = 1
BLAST of Cp4.1LG14g01830 vs. TAIR10
Match: AT2G18140.1 (AT2G18140.1 Peroxidase superfamily protein) HSP 1 Score: 69.7 bits (169), Expect = 1.1e-12 Identity = 32/52 (61.54%), Postives = 40/52 (76.92%), Query Frame = 1
BLAST of Cp4.1LG14g01830 vs. TAIR10
Match: AT4G36430.1 (AT4G36430.1 Peroxidase superfamily protein) HSP 1 Score: 68.6 bits (166), Expect = 2.5e-12 Identity = 30/49 (61.22%), Postives = 38/49 (77.55%), Query Frame = 1
BLAST of Cp4.1LG14g01830 vs. TAIR10
Match: AT3G50990.1 (AT3G50990.1 Peroxidase superfamily protein) HSP 1 Score: 68.6 bits (166), Expect = 2.5e-12 Identity = 30/45 (66.67%), Postives = 35/45 (77.78%), Query Frame = 1
BLAST of Cp4.1LG14g01830 vs. TAIR10
Match: AT2G18150.1 (AT2G18150.1 Peroxidase superfamily protein) HSP 1 Score: 67.4 bits (163), Expect = 5.5e-12 Identity = 32/52 (61.54%), Postives = 40/52 (76.92%), Query Frame = 1
BLAST of Cp4.1LG14g01830 vs. NCBI nr
Match: gi|659102408|ref|XP_008452113.1| (PREDICTED: peroxidase 72-like [Cucumis melo]) HSP 1 Score: 110.9 bits (276), Expect = 1.2e-21 Identity = 66/93 (70.97%), Postives = 69/93 (74.19%), Query Frame = 1
BLAST of Cp4.1LG14g01830 vs. NCBI nr
Match: gi|449457510|ref|XP_004146491.1| (PREDICTED: peroxidase 72 [Cucumis sativus]) HSP 1 Score: 110.2 bits (274), Expect = 2.1e-21 Identity = 64/93 (68.82%), Postives = 68/93 (73.12%), Query Frame = 1
BLAST of Cp4.1LG14g01830 vs. NCBI nr
Match: gi|728828588|gb|KHG08031.1| (Peroxidase 72 -like protein [Gossypium arboreum]) HSP 1 Score: 97.8 bits (242), Expect = 1.1e-17 Identity = 57/93 (61.29%), Postives = 63/93 (67.74%), Query Frame = 1
BLAST of Cp4.1LG14g01830 vs. NCBI nr
Match: gi|823191954|ref|XP_012491616.1| (PREDICTED: peroxidase 72-like [Gossypium raimondii]) HSP 1 Score: 95.1 bits (235), Expect = 7.0e-17 Identity = 56/93 (60.22%), Postives = 62/93 (66.67%), Query Frame = 1
BLAST of Cp4.1LG14g01830 vs. NCBI nr
Match: gi|719988594|ref|XP_010252387.1| (PREDICTED: peroxidase 72-like [Nelumbo nucifera]) HSP 1 Score: 94.0 bits (232), Expect = 1.6e-16 Identity = 55/93 (59.14%), Postives = 60/93 (64.52%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|