Cp4.1LG13g00300 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTTCTTCCAAGTGAAGTACCTGAAGAAAGCTACTTTTGGACGATCCAAACCGATGACAACAACGATAATCTTCCGAACATGGTCTCGAGCGGTTGCGATGAGGAGCGAGCTAAAACGGTGGACGAAAGAAGGCAAAGGAGGATGATATCGAATCGAGAATCAGCTCGAAGGTCCCGAATGAGGAAGCAGAAGCATCTGAACCAGCTATGGTCTCAACTGGCTCGGCTTTGCAATGAGAACCGTGATCTTGAGGAGAAGGTGAGCCGTTTGATGGAGTCTCAGCAGCTCCTTCTCCAAGAGAATGCTAATCTTAAACAACAAGTTTCGGGTTTTCGACAAATCTTAAGGGACATGGAACTTGAACAACAACTTGTCGCCCAATTTTGA ATGCTTCTTCCAAGTGAAGTACCTGAAGAAAGCTACTTTTGGACGATCCAAACCGATGACAACAACGATAATCTTCCGAACATGGTCTCGAGCGGTTGCGATGAGGAGCGAGCTAAAACGGTGGACGAAAGAAGGCAAAGGAGGATGATATCGAATCGAGAATCAGCTCGAAGGTCCCGAATGAGGAAGCAGAAGCATCTGAACCAGCTATGGTCTCAACTGGCTCGGCTTTGCAATGAGAACCGTGATCTTGAGGAGAAGGTGAGCCGTTTGATGGAGTCTCAGCAGCTCCTTCTCCAAGAGAATGCTAATCTTAAACAACAAGTTTCGGGTTTTCGACAAATCTTAAGGGACATGGAACTTGAACAACAACTTGTCGCCCAATTTTGA ATGCTTCTTCCAAGTGAAGTACCTGAAGAAAGCTACTTTTGGACGATCCAAACCGATGACAACAACGATAATCTTCCGAACATGGTCTCGAGCGGTTGCGATGAGGAGCGAGCTAAAACGGTGGACGAAAGAAGGCAAAGGAGGATGATATCGAATCGAGAATCAGCTCGAAGGTCCCGAATGAGGAAGCAGAAGCATCTGAACCAGCTATGGTCTCAACTGGCTCGGCTTTGCAATGAGAACCGTGATCTTGAGGAGAAGGTGAGCCGTTTGATGGAGTCTCAGCAGCTCCTTCTCCAAGAGAATGCTAATCTTAAACAACAAGTTTCGGGTTTTCGACAAATCTTAAGGGACATGGAACTTGAACAACAACTTGTCGCCCAATTTTGA MLLPSEVPEESYFWTIQTDDNNDNLPNMVSSGCDEERAKTVDERRQRRMISNRESARRSRMRKQKHLNQLWSQLARLCNENRDLEEKVSRLMESQQLLLQENANLKQQVSGFRQILRDMELEQQLVAQF
BLAST of Cp4.1LG13g00300 vs. Swiss-Prot
Match: BZP43_ARATH (Basic leucine zipper 43 OS=Arabidopsis thaliana GN=BZIP43 PE=1 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 3.0e-15 Identity = 46/118 (38.98%), Postives = 80/118 (67.80%), Query Frame = 1
BLAST of Cp4.1LG13g00300 vs. Swiss-Prot
Match: BZIP8_ARATH (Basic leucine zipper 8 OS=Arabidopsis thaliana GN=BZIP8 PE=1 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 6.3e-13 Identity = 46/123 (37.40%), Postives = 78/123 (63.41%), Query Frame = 1
BLAST of Cp4.1LG13g00300 vs. Swiss-Prot
Match: BZIP2_ARATH (bZIP transcription factor 2 OS=Arabidopsis thaliana GN=BZIP2 PE=1 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 2.3e-07 Identity = 33/70 (47.14%), Postives = 50/70 (71.43%), Query Frame = 1
BLAST of Cp4.1LG13g00300 vs. Swiss-Prot
Match: AI5L5_ARATH (ABSCISIC ACID-INSENSITIVE 5-like protein 5 OS=Arabidopsis thaliana GN=ABF2 PE=1 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 1.1e-06 Identity = 39/85 (45.88%), Postives = 54/85 (63.53%), Query Frame = 1
BLAST of Cp4.1LG13g00300 vs. Swiss-Prot
Match: BZP53_ARATH (bZIP transcription factor 53 OS=Arabidopsis thaliana GN=BZIP53 PE=1 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 7.4e-06 Identity = 41/113 (36.28%), Postives = 60/113 (53.10%), Query Frame = 1
BLAST of Cp4.1LG13g00300 vs. TrEMBL
Match: B9HWS1_POPTR (BZIP family protein OS=Populus trichocarpa GN=POPTR_0010s14530g PE=4 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 3.5e-18 Identity = 58/117 (49.57%), Postives = 80/117 (68.38%), Query Frame = 1
BLAST of Cp4.1LG13g00300 vs. TrEMBL
Match: A0A061E947_THECC (Basic leucine-zipper 42 OS=Theobroma cacao GN=TCM_011390 PE=4 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 5.9e-18 Identity = 56/117 (47.86%), Postives = 82/117 (70.09%), Query Frame = 1
BLAST of Cp4.1LG13g00300 vs. TrEMBL
Match: A0A0D2PWI5_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G251000 PE=4 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 7.7e-18 Identity = 56/115 (48.70%), Postives = 80/115 (69.57%), Query Frame = 1
BLAST of Cp4.1LG13g00300 vs. TrEMBL
Match: M5WTK9_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa011644mg PE=4 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 1.7e-17 Identity = 54/95 (56.84%), Postives = 70/95 (73.68%), Query Frame = 1
BLAST of Cp4.1LG13g00300 vs. TrEMBL
Match: V7BZS9_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_004G045800g PE=4 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 1.7e-17 Identity = 53/95 (55.79%), Postives = 71/95 (74.74%), Query Frame = 1
BLAST of Cp4.1LG13g00300 vs. TAIR10
Match: AT1G13600.1 (AT1G13600.1 basic leucine-zipper 58) HSP 1 Score: 92.0 bits (227), Expect = 2.8e-19 Identity = 56/129 (43.41%), Postives = 84/129 (65.12%), Query Frame = 1
BLAST of Cp4.1LG13g00300 vs. TAIR10
Match: AT2G04038.1 (AT2G04038.1 basic leucine-zipper 48) HSP 1 Score: 87.4 bits (215), Expect = 6.9e-18 Identity = 50/106 (47.17%), Postives = 79/106 (74.53%), Query Frame = 1
BLAST of Cp4.1LG13g00300 vs. TAIR10
Match: AT3G30530.1 (AT3G30530.1 basic leucine-zipper 42) HSP 1 Score: 84.3 bits (207), Expect = 5.8e-17 Identity = 48/98 (48.98%), Postives = 70/98 (71.43%), Query Frame = 1
BLAST of Cp4.1LG13g00300 vs. TAIR10
Match: AT5G38800.1 (AT5G38800.1 basic leucine-zipper 43) HSP 1 Score: 82.8 bits (203), Expect = 1.7e-16 Identity = 46/118 (38.98%), Postives = 80/118 (67.80%), Query Frame = 1
BLAST of Cp4.1LG13g00300 vs. TAIR10
Match: AT5G15830.1 (AT5G15830.1 basic leucine-zipper 3) HSP 1 Score: 75.9 bits (185), Expect = 2.1e-14 Identity = 43/94 (45.74%), Postives = 69/94 (73.40%), Query Frame = 1
BLAST of Cp4.1LG13g00300 vs. NCBI nr
Match: gi|659089912|ref|XP_008445746.1| (PREDICTED: ocs element-binding factor 1-like [Cucumis melo]) HSP 1 Score: 137.5 bits (345), Expect = 1.6e-29 Identity = 83/134 (61.94%), Postives = 96/134 (71.64%), Query Frame = 1
BLAST of Cp4.1LG13g00300 vs. NCBI nr
Match: gi|224111822|ref|XP_002315989.1| (bZIP family protein [Populus trichocarpa]) HSP 1 Score: 99.4 bits (246), Expect = 5.0e-18 Identity = 58/117 (49.57%), Postives = 80/117 (68.38%), Query Frame = 1
BLAST of Cp4.1LG13g00300 vs. NCBI nr
Match: gi|743797842|ref|XP_011009140.1| (PREDICTED: basic leucine zipper 43-like [Populus euphratica]) HSP 1 Score: 99.0 bits (245), Expect = 6.5e-18 Identity = 58/117 (49.57%), Postives = 80/117 (68.38%), Query Frame = 1
BLAST of Cp4.1LG13g00300 vs. NCBI nr
Match: gi|720006062|ref|XP_010257863.1| (PREDICTED: basic leucine zipper 43-like [Nelumbo nucifera]) HSP 1 Score: 98.6 bits (244), Expect = 8.5e-18 Identity = 54/101 (53.47%), Postives = 74/101 (73.27%), Query Frame = 1
BLAST of Cp4.1LG13g00300 vs. NCBI nr
Match: gi|590698352|ref|XP_007045693.1| (Basic leucine-zipper 42 [Theobroma cacao]) HSP 1 Score: 98.6 bits (244), Expect = 8.5e-18 Identity = 56/117 (47.86%), Postives = 82/117 (70.09%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|