Cp4.1LG12g00420 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGTTTCCACGGATTGCCATTGGCTGTGGCCATGACAATGCTGGCTCTTTTGATTCTAAGGTTTCTGGGATTGTTGGGCTCAGTCATGGTTCAGCTTCGCTTGTCCAGCAGATGGGGCCGGCCACCGGCGGAAAATTCTCTTACTGTTTGGCACCCATCGGAAACTCTAACTACTCGAGCTATCTTAACTTCGGCTCTAATGCTGTCGTCTCTGGCTCTGGAGCCGTCTCAACTTCGATTTATACTAGCGGTAAATACCAATGTTTTTTTATCGATAAAATGATTAGTGGTTTAAGTATATAA ATGGCGTTTCCACGGATTGCCATTGGCTGTGGCCATGACAATGCTGGCTCTTTTGATTCTAAGGTTTCTGGGATTGTTGGGCTCAGTCATGGTTCAGCTTCGCTTGTCCAGCAGATGGGGCCGGCCACCGGCGGAAAATTCTCTTACTGTTTGGCACCCATCGGAAACTCTAACTACTCGAGCTATCTTAACTTCGGCTCTAATGCTGTCGTCTCTGGCTCTGGAGCCGTCTCAACTTCGATTTATACTAGCGGTAAATACCAATGTTTTTTTATCGATAAAATGATTAGTGGTTTAAGTATATAA ATGGCGTTTCCACGGATTGCCATTGGCTGTGGCCATGACAATGCTGGCTCTTTTGATTCTAAGGTTTCTGGGATTGTTGGGCTCAGTCATGGTTCAGCTTCGCTTGTCCAGCAGATGGGGCCGGCCACCGGCGGAAAATTCTCTTACTGTTTGGCACCCATCGGAAACTCTAACTACTCGAGCTATCTTAACTTCGGCTCTAATGCTGTCGTCTCTGGCTCTGGAGCCGTCTCAACTTCGATTTATACTAGCGGTAAATACCAATGTTTTTTTATCGATAAAATGATTAGTGGTTTAAGTATATAA MAFPRIAIGCGHDNAGSFDSKVSGIVGLSHGSASLVQQMGPATGGKFSYCLAPIGNSNYSSYLNFGSNAVVSGSGAVSTSIYTSGKYQCFFIDKMISGLSI
BLAST of Cp4.1LG12g00420 vs. Swiss-Prot
Match: CDR1_ARATH (Aspartic proteinase CDR1 OS=Arabidopsis thaliana GN=CDR1 PE=1 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 2.3e-18 Identity = 46/92 (50.00%), Postives = 62/92 (67.39%), Query Frame = 1
BLAST of Cp4.1LG12g00420 vs. Swiss-Prot
Match: ASPR1_ARATH (Probable aspartic protease At2g35615 OS=Arabidopsis thaliana GN=At2g35615 PE=3 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.7e-10 Identity = 36/86 (41.86%), Postives = 53/86 (61.63%), Query Frame = 1
BLAST of Cp4.1LG12g00420 vs. TrEMBL
Match: A0A0A0K9V4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G078630 PE=3 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 9.3e-27 Identity = 67/96 (69.79%), Postives = 77/96 (80.21%), Query Frame = 1
BLAST of Cp4.1LG12g00420 vs. TrEMBL
Match: A0A0A0K928_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G078650 PE=3 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 1.6e-26 Identity = 65/97 (67.01%), Postives = 78/97 (80.41%), Query Frame = 1
BLAST of Cp4.1LG12g00420 vs. TrEMBL
Match: V7BTM4_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_005G063600g PE=3 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 7.1e-19 Identity = 57/101 (56.44%), Postives = 71/101 (70.30%), Query Frame = 1
BLAST of Cp4.1LG12g00420 vs. TrEMBL
Match: I1KTI4_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_08G149900 PE=3 SV=2) HSP 1 Score: 100.9 bits (250), Expect = 9.3e-19 Identity = 53/101 (52.48%), Postives = 70/101 (69.31%), Query Frame = 1
BLAST of Cp4.1LG12g00420 vs. TrEMBL
Match: A0A059C519_EUCGR (Uncharacterized protein (Fragment) OS=Eucalyptus grandis GN=EUGRSUZ_E01757 PE=3 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 2.1e-18 Identity = 47/81 (58.02%), Postives = 60/81 (74.07%), Query Frame = 1
BLAST of Cp4.1LG12g00420 vs. TAIR10
Match: AT5G33340.1 (AT5G33340.1 Eukaryotic aspartyl protease family protein) HSP 1 Score: 92.8 bits (229), Expect = 1.3e-19 Identity = 46/92 (50.00%), Postives = 62/92 (67.39%), Query Frame = 1
BLAST of Cp4.1LG12g00420 vs. TAIR10
Match: AT1G64830.1 (AT1G64830.1 Eukaryotic aspartyl protease family protein) HSP 1 Score: 82.4 bits (202), Expect = 1.7e-16 Identity = 42/87 (48.28%), Postives = 56/87 (64.37%), Query Frame = 1
BLAST of Cp4.1LG12g00420 vs. TAIR10
Match: AT2G28030.1 (AT2G28030.1 Eukaryotic aspartyl protease family protein) HSP 1 Score: 67.8 bits (164), Expect = 4.4e-12 Identity = 40/91 (43.96%), Postives = 56/91 (61.54%), Query Frame = 1
BLAST of Cp4.1LG12g00420 vs. TAIR10
Match: AT1G31450.1 (AT1G31450.1 Eukaryotic aspartyl protease family protein) HSP 1 Score: 66.6 bits (161), Expect = 9.9e-12 Identity = 34/84 (40.48%), Postives = 52/84 (61.90%), Query Frame = 1
BLAST of Cp4.1LG12g00420 vs. TAIR10
Match: AT2G35615.1 (AT2G35615.1 Eukaryotic aspartyl protease family protein) HSP 1 Score: 66.6 bits (161), Expect = 9.9e-12 Identity = 36/86 (41.86%), Postives = 53/86 (61.63%), Query Frame = 1
BLAST of Cp4.1LG12g00420 vs. NCBI nr
Match: gi|659120454|ref|XP_008460202.1| (PREDICTED: uncharacterized protein LOC103499087 [Cucumis melo]) HSP 1 Score: 130.2 bits (326), Expect = 2.1e-27 Identity = 67/97 (69.07%), Postives = 79/97 (81.44%), Query Frame = 1
BLAST of Cp4.1LG12g00420 vs. NCBI nr
Match: gi|700191064|gb|KGN46268.1| (hypothetical protein Csa_6G078630 [Cucumis sativus]) HSP 1 Score: 127.5 bits (319), Expect = 1.3e-26 Identity = 67/96 (69.79%), Postives = 77/96 (80.21%), Query Frame = 1
BLAST of Cp4.1LG12g00420 vs. NCBI nr
Match: gi|778722025|ref|XP_004153020.2| (PREDICTED: aspartic proteinase CDR1-like [Cucumis sativus]) HSP 1 Score: 127.5 bits (319), Expect = 1.3e-26 Identity = 67/96 (69.79%), Postives = 77/96 (80.21%), Query Frame = 1
BLAST of Cp4.1LG12g00420 vs. NCBI nr
Match: gi|700191066|gb|KGN46270.1| (hypothetical protein Csa_6G078650 [Cucumis sativus]) HSP 1 Score: 126.7 bits (317), Expect = 2.3e-26 Identity = 65/97 (67.01%), Postives = 78/97 (80.41%), Query Frame = 1
BLAST of Cp4.1LG12g00420 vs. NCBI nr
Match: gi|1009110301|ref|XP_015894852.1| (PREDICTED: aspartic proteinase CDR1-like [Ziziphus jujuba]) HSP 1 Score: 104.4 bits (259), Expect = 1.2e-19 Identity = 54/91 (59.34%), Postives = 66/91 (72.53%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |