Cp4.1LG11g07900 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCGGGCAGTGGACCCAAACCGACCAAGTAAGTCTCACAACTTGGTGAAGTGGGCCAAGCCATCACTGAGCAACAAGAAGAAGATGACGAAACTAATGGACCCAAGACTTGGGGACGACTACTCGCCCGGAGGAGCCTGGGGCACAGCTGAACTCATTTTAAAATGTTTGAAAATGGACCCCAGAGATCGGCCCTCCATGGAAGAGGTTTTGGTGACCCTTGAAGAAATCAGTACCTTCACAGACAGGCCCAAGAAGAAGCCCAAATCAACAGCTAGGAAGCCCAGACCTTAA ATGCGGGCAGTGGACCCAAACCGACCAAGTAAGTCTCACAACTTGGTGAAGTGGGCCAAGCCATCACTGAGCAACAAGAAGAAGATGACGAAACTAATGGACCCAAGACTTGGGGACGACTACTCGCCCGGAGGAGCCTGGGGCACAGCTGAACTCATTTTAAAATGTTTGAAAATGGACCCCAGAGATCGGCCCTCCATGGAAGAGGTTTTGGTGACCCTTGAAGAAATCAGTACCTTCACAGACAGGCCCAAGAAGAAGCCCAAATCAACAGCTAGGAAGCCCAGACCTTAA ATGCGGGCAGTGGACCCAAACCGACCAAGTAAGTCTCACAACTTGGTGAAGTGGGCCAAGCCATCACTGAGCAACAAGAAGAAGATGACGAAACTAATGGACCCAAGACTTGGGGACGACTACTCGCCCGGAGGAGCCTGGGGCACAGCTGAACTCATTTTAAAATGTTTGAAAATGGACCCCAGAGATCGGCCCTCCATGGAAGAGGTTTTGGTGACCCTTGAAGAAATCAGTACCTTCACAGACAGGCCCAAGAAGAAGCCCAAATCAACAGCTAGGAAGCCCAGACCTTAA MRAVDPNRPSKSHNLVKWAKPSLSNKKKMTKLMDPRLGDDYSPGGAWGTAELILKCLKMDPRDRPSMEEVLVTLEEISTFTDRPKKKPKSTARKPRP
BLAST of Cp4.1LG11g07900 vs. Swiss-Prot
Match: NAK_ARATH (Probable serine/threonine-protein kinase NAK OS=Arabidopsis thaliana GN=NAK PE=1 SV=2) HSP 1 Score: 77.8 bits (190), Expect = 7.3e-14 Identity = 36/86 (41.86%), Postives = 56/86 (65.12%), Query Frame = 1
BLAST of Cp4.1LG11g07900 vs. Swiss-Prot
Match: APK1A_ARATH (Protein kinase APK1A, chloroplastic OS=Arabidopsis thaliana GN=APK1A PE=2 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 1.1e-12 Identity = 39/78 (50.00%), Postives = 51/78 (65.38%), Query Frame = 1
BLAST of Cp4.1LG11g07900 vs. Swiss-Prot
Match: Y3545_ARATH (Probable receptor-like protein kinase At3g55450 OS=Arabidopsis thaliana GN=At3g55450 PE=1 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.8e-12 Identity = 31/83 (37.35%), Postives = 54/83 (65.06%), Query Frame = 1
BLAST of Cp4.1LG11g07900 vs. Swiss-Prot
Match: Y5102_ARATH (Serine/threonine-protein kinase At5g01020 OS=Arabidopsis thaliana GN=At5g01020 PE=1 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.8e-12 Identity = 34/81 (41.98%), Postives = 50/81 (61.73%), Query Frame = 1
BLAST of Cp4.1LG11g07900 vs. Swiss-Prot
Match: Y5158_ARATH (Probable receptor-like protein kinase At5g15080 OS=Arabidopsis thaliana GN=At5g15080 PE=2 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.8e-12 Identity = 33/81 (40.74%), Postives = 51/81 (62.96%), Query Frame = 1
BLAST of Cp4.1LG11g07900 vs. TrEMBL
Match: A0A0A0KGQ6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G356490 PE=3 SV=1) HSP 1 Score: 147.5 bits (371), Expect = 8.3e-33 Identity = 74/95 (77.89%), Postives = 82/95 (86.32%), Query Frame = 1
BLAST of Cp4.1LG11g07900 vs. TrEMBL
Match: E5GBY8_CUCME (Serine/threonine-protein kinase cx32 OS=Cucumis melo subsp. melo PE=3 SV=1) HSP 1 Score: 146.7 bits (369), Expect = 1.4e-32 Identity = 73/95 (76.84%), Postives = 82/95 (86.32%), Query Frame = 1
BLAST of Cp4.1LG11g07900 vs. TrEMBL
Match: A0A061FE08_THECC (Kinase superfamily protein OS=Theobroma cacao GN=TCM_034395 PE=3 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 3.6e-20 Identity = 52/94 (55.32%), Postives = 68/94 (72.34%), Query Frame = 1
BLAST of Cp4.1LG11g07900 vs. TrEMBL
Match: B9R8N8_RICCO (Serine/threonine-protein kinase cx32, putative OS=Ricinus communis GN=RCOM_1601170 PE=3 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 1.1e-19 Identity = 52/93 (55.91%), Postives = 69/93 (74.19%), Query Frame = 1
BLAST of Cp4.1LG11g07900 vs. TrEMBL
Match: A0A0D2NAV4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G114200 PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.4e-19 Identity = 52/94 (55.32%), Postives = 69/94 (73.40%), Query Frame = 1
BLAST of Cp4.1LG11g07900 vs. TAIR10
Match: AT1G76360.1 (AT1G76360.1 Protein kinase superfamily protein) HSP 1 Score: 97.8 bits (242), Expect = 3.8e-21 Identity = 47/95 (49.47%), Postives = 66/95 (69.47%), Query Frame = 1
BLAST of Cp4.1LG11g07900 vs. TAIR10
Match: AT2G17220.1 (AT2G17220.1 Protein kinase superfamily protein) HSP 1 Score: 83.2 bits (204), Expect = 9.8e-17 Identity = 39/92 (42.39%), Postives = 60/92 (65.22%), Query Frame = 1
BLAST of Cp4.1LG11g07900 vs. TAIR10
Match: AT5G02290.1 (AT5G02290.1 Protein kinase superfamily protein) HSP 1 Score: 77.8 bits (190), Expect = 4.1e-15 Identity = 36/86 (41.86%), Postives = 56/86 (65.12%), Query Frame = 1
BLAST of Cp4.1LG11g07900 vs. TAIR10
Match: AT1G07570.3 (AT1G07570.3 Protein kinase superfamily protein) HSP 1 Score: 73.9 bits (180), Expect = 5.9e-14 Identity = 39/78 (50.00%), Postives = 51/78 (65.38%), Query Frame = 1
BLAST of Cp4.1LG11g07900 vs. TAIR10
Match: AT2G05940.1 (AT2G05940.1 Protein kinase superfamily protein) HSP 1 Score: 73.2 bits (178), Expect = 1.0e-13 Identity = 34/83 (40.96%), Postives = 51/83 (61.45%), Query Frame = 1
BLAST of Cp4.1LG11g07900 vs. NCBI nr
Match: gi|449452989|ref|XP_004144241.1| (PREDICTED: probable serine/threonine-protein kinase NAK [Cucumis sativus]) HSP 1 Score: 147.5 bits (371), Expect = 1.2e-32 Identity = 74/95 (77.89%), Postives = 82/95 (86.32%), Query Frame = 1
BLAST of Cp4.1LG11g07900 vs. NCBI nr
Match: gi|307136143|gb|ADN33987.1| (serine/threonine-protein kinase cx32 [Cucumis melo subsp. melo]) HSP 1 Score: 146.7 bits (369), Expect = 2.0e-32 Identity = 73/95 (76.84%), Postives = 82/95 (86.32%), Query Frame = 1
BLAST of Cp4.1LG11g07900 vs. NCBI nr
Match: gi|659131370|ref|XP_008465651.1| (PREDICTED: probable serine/threonine-protein kinase NAK, partial [Cucumis melo]) HSP 1 Score: 146.7 bits (369), Expect = 2.0e-32 Identity = 73/95 (76.84%), Postives = 82/95 (86.32%), Query Frame = 1
BLAST of Cp4.1LG11g07900 vs. NCBI nr
Match: gi|645265078|ref|XP_008237981.1| (PREDICTED: probable serine/threonine-protein kinase NAK [Prunus mume]) HSP 1 Score: 106.7 bits (265), Expect = 2.3e-20 Identity = 53/94 (56.38%), Postives = 68/94 (72.34%), Query Frame = 1
BLAST of Cp4.1LG11g07900 vs. NCBI nr
Match: gi|470132210|ref|XP_004301978.1| (PREDICTED: probable serine/threonine-protein kinase NAK [Fragaria vesca subsp. vesca]) HSP 1 Score: 105.9 bits (263), Expect = 4.0e-20 Identity = 49/84 (58.33%), Postives = 63/84 (75.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |