Cp4.1LG11g07460 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAGACAGCTCTCAAAGTTTGAGCTACCAAGTTGGAGAAGCCAAGGGCCAAGCACAGGTTCACCATGTCATTATTATTTGTTTAAATGGTTCATGATAGATATGAGTACATGGAGTGATGGGTAACATAGTTATTAATGTGATTATGTAGGAGAAGGCGAGTAATGTGATGGATAGGGCGAGTGATGCAGCCCAATCAACTAAGGAGTCATTACAAGAGGCAGGACAACAGATGCAGGCTAAAGCACAAGGTGCAGTTGATGCGGTCAAAGATGCTAGTGGCATGAAGAAATGA ATGGCAGACAGCTCTCAAAGTTTGAGCTACCAAGTTGGAGAAGCCAAGGGCCAAGCACAGGAGAAGGCGAGTAATGTGATGGATAGGGCGAGTGATGCAGCCCAATCAACTAAGGAGTCATTACAAGAGGCAGGACAACAGATGCAGGCTAAAGCACAAGGTGCAGTTGATGCGGTCAAAGATGCTAGTGGCATGAAGAAATGA ATGGCAGACAGCTCTCAAAGTTTGAGCTACCAAGTTGGAGAAGCCAAGGGCCAAGCACAGGAGAAGGCGAGTAATGTGATGGATAGGGCGAGTGATGCAGCCCAATCAACTAAGGAGTCATTACAAGAGGCAGGACAACAGATGCAGGCTAAAGCACAAGGTGCAGTTGATGCGGTCAAAGATGCTAGTGGCATGAAGAAATGA MADSSQSLSYQVGEAKGQAQEKASNVMDRASDAAQSTKESLQEAGQQMQAKAQGAVDAVKDASGMKK
BLAST of Cp4.1LG11g07460 vs. TrEMBL
Match: A0A0A0KPD4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G165870 PE=4 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 3.1e-18 Identity = 53/67 (79.10%), Postives = 63/67 (94.03%), Query Frame = 1
BLAST of Cp4.1LG11g07460 vs. TrEMBL
Match: A0A0A0KRE1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G165860 PE=4 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 3.4e-17 Identity = 51/67 (76.12%), Postives = 60/67 (89.55%), Query Frame = 1
BLAST of Cp4.1LG11g07460 vs. TrEMBL
Match: A0A0A0KVV6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G643260 PE=4 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 1.4e-15 Identity = 48/67 (71.64%), Postives = 59/67 (88.06%), Query Frame = 1
BLAST of Cp4.1LG11g07460 vs. TrEMBL
Match: A0A061EH65_THECC (Late embryogenesis abundant protein family protein OS=Theobroma cacao GN=TCM_019635 PE=4 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 1.9e-15 Identity = 49/67 (73.13%), Postives = 59/67 (88.06%), Query Frame = 1
BLAST of Cp4.1LG11g07460 vs. TrEMBL
Match: B9H3T9_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0004s10750g PE=4 SV=2) HSP 1 Score: 88.2 bits (217), Expect = 4.1e-15 Identity = 48/67 (71.64%), Postives = 59/67 (88.06%), Query Frame = 1
BLAST of Cp4.1LG11g07460 vs. TAIR10
Match: AT5G38760.1 (AT5G38760.1 Late embryogenesis abundant protein (LEA) family protein) HSP 1 Score: 78.2 bits (191), Expect = 2.2e-15 Identity = 42/67 (62.69%), Postives = 58/67 (86.57%), Query Frame = 1
BLAST of Cp4.1LG11g07460 vs. TAIR10
Match: AT5G53820.1 (AT5G53820.1 Late embryogenesis abundant protein (LEA) family protein) HSP 1 Score: 75.1 bits (183), Expect = 1.8e-14 Identity = 39/67 (58.21%), Postives = 57/67 (85.07%), Query Frame = 1
BLAST of Cp4.1LG11g07460 vs. TAIR10
Match: AT3G02480.1 (AT3G02480.1 Late embryogenesis abundant protein (LEA) family protein) HSP 1 Score: 70.1 bits (170), Expect = 5.9e-13 Identity = 38/65 (58.46%), Postives = 49/65 (75.38%), Query Frame = 1
BLAST of Cp4.1LG11g07460 vs. NCBI nr
Match: gi|449469355|ref|XP_004152386.1| (PREDICTED: stress-induced protein KIN2-like [Cucumis sativus]) HSP 1 Score: 98.6 bits (244), Expect = 4.4e-18 Identity = 53/67 (79.10%), Postives = 63/67 (94.03%), Query Frame = 1
BLAST of Cp4.1LG11g07460 vs. NCBI nr
Match: gi|659073373|ref|XP_008437025.1| (PREDICTED: stress-induced protein KIN2-like [Cucumis melo]) HSP 1 Score: 98.2 bits (243), Expect = 5.7e-18 Identity = 54/67 (80.60%), Postives = 61/67 (91.04%), Query Frame = 1
BLAST of Cp4.1LG11g07460 vs. NCBI nr
Match: gi|659119050|ref|XP_008459448.1| (PREDICTED: stress-induced protein KIN2-like [Cucumis melo]) HSP 1 Score: 96.3 bits (238), Expect = 2.2e-17 Identity = 52/67 (77.61%), Postives = 61/67 (91.04%), Query Frame = 1
BLAST of Cp4.1LG11g07460 vs. NCBI nr
Match: gi|449469357|ref|XP_004152387.1| (PREDICTED: stress-induced protein KIN2-like [Cucumis sativus]) HSP 1 Score: 95.1 bits (235), Expect = 4.9e-17 Identity = 51/67 (76.12%), Postives = 60/67 (89.55%), Query Frame = 1
BLAST of Cp4.1LG11g07460 vs. NCBI nr
Match: gi|1009127017|ref|XP_015880470.1| (PREDICTED: stress-induced protein KIN2-like [Ziziphus jujuba]) HSP 1 Score: 93.2 bits (230), Expect = 1.8e-16 Identity = 51/66 (77.27%), Postives = 60/66 (90.91%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|