Cp4.1LG10g08200 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAATCTATGCCCATGTCTCCTCCAGCCATGGATGGCAGAGATACTCCAATGATGCAGATGAGCTTCTACTGGGGCAAAGAGGCAGTGGTTCTCTTTTCAGGGTGGCCTAAACAGAGTGTTGGCATGTACATACTGGCCTTCTTCTTCATCTTCCTGCTGGCCTTCGCCATCGAGTTCTTGAGCCACACGCAGCCAACCAAGCTTCCCAAGAGCCCTGTTGCCAGCGCCTCCATTCAGGCCCTCGTCTATGCTTTCAGGACAGGGTTGGCTTATCTGGTCATGTTGGCTGTTATGTCCTTCAACGTTGGGATGTTTATAGCGGCTGTGGCAGGGCATAGTCTTGGATATTTTGTTCTCAAACTTCGTGCTCTTACTGCTGGAAAGAGGAGTGATTGTAATGAAGTTTGA ATGGAATCTATGCCCATGTCTCCTCCAGCCATGGATGGCAGAGATACTCCAATGATGCAGATGAGCTTCTACTGGGGCAAAGAGGCAGTGGTTCTCTTTTCAGGGTGGCCTAAACAGAGTGTTGGCATGTACATACTGGCCTTCTTCTTCATCTTCCTGCTGGCCTTCGCCATCGAGTTCTTGAGCCACACGCAGCCAACCAAGCTTCCCAAGAGCCCTGTTGCCAGCGCCTCCATTCAGGCCCTCGTCTATGCTTTCAGGACAGGGTTGGCTTATCTGGTCATGTTGGCTGTTATGTCCTTCAACGTTGGGATGTTTATAGCGGCTGTGGCAGGGCATAGTCTTGGATATTTTGTTCTCAAACTTCGTGCTCTTACTGCTGGAAAGAGGAGTGATTGTAATGAAGTTTGA ATGGAATCTATGCCCATGTCTCCTCCAGCCATGGATGGCAGAGATACTCCAATGATGCAGATGAGCTTCTACTGGGGCAAAGAGGCAGTGGTTCTCTTTTCAGGGTGGCCTAAACAGAGTGTTGGCATGTACATACTGGCCTTCTTCTTCATCTTCCTGCTGGCCTTCGCCATCGAGTTCTTGAGCCACACGCAGCCAACCAAGCTTCCCAAGAGCCCTGTTGCCAGCGCCTCCATTCAGGCCCTCGTCTATGCTTTCAGGACAGGGTTGGCTTATCTGGTCATGTTGGCTGTTATGTCCTTCAACGTTGGGATGTTTATAGCGGCTGTGGCAGGGCATAGTCTTGGATATTTTGTTCTCAAACTTCGTGCTCTTACTGCTGGAAAGAGGAGTGATTGTAATGAAGTTTGA MESMPMSPPAMDGRDTPMMQMSFYWGKEAVVLFSGWPKQSVGMYILAFFFIFLLAFAIEFLSHTQPTKLPKSPVASASIQALVYAFRTGLAYLVMLAVMSFNVGMFIAAVAGHSLGYFVLKLRALTAGKRSDCNEV
BLAST of Cp4.1LG10g08200 vs. Swiss-Prot
Match: COPT2_ARATH (Copper transporter 2 OS=Arabidopsis thaliana GN=COPT2 PE=2 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 1.0e-21 Identity = 61/126 (48.41%), Postives = 79/126 (62.70%), Query Frame = 1
BLAST of Cp4.1LG10g08200 vs. Swiss-Prot
Match: COPT6_ARATH (Copper transporter 6 OS=Arabidopsis thaliana GN=COPT6 PE=2 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 8.6e-21 Identity = 55/119 (46.22%), Postives = 76/119 (63.87%), Query Frame = 1
BLAST of Cp4.1LG10g08200 vs. Swiss-Prot
Match: COPT1_ARATH (Copper transporter 1 OS=Arabidopsis thaliana GN=COPT1 PE=2 SV=2) HSP 1 Score: 100.1 bits (248), Expect = 1.9e-20 Identity = 53/105 (50.48%), Postives = 69/105 (65.71%), Query Frame = 1
BLAST of Cp4.1LG10g08200 vs. Swiss-Prot
Match: COPT3_ORYSJ (Copper transporter 3 OS=Oryza sativa subsp. japonica GN=COPT3 PE=2 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 8.1e-19 Identity = 58/124 (46.77%), Postives = 76/124 (61.29%), Query Frame = 1
BLAST of Cp4.1LG10g08200 vs. Swiss-Prot
Match: COPT2_ORYSJ (Copper transporter 2 OS=Oryza sativa subsp. japonica GN=COPT2 PE=1 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 3.1e-18 Identity = 52/121 (42.98%), Postives = 75/121 (61.98%), Query Frame = 1
BLAST of Cp4.1LG10g08200 vs. TrEMBL
Match: A0A0A0KZS9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G303720 PE=4 SV=1) HSP 1 Score: 194.9 bits (494), Expect = 6.4e-47 Identity = 106/150 (70.67%), Postives = 125/150 (83.33%), Query Frame = 1
BLAST of Cp4.1LG10g08200 vs. TrEMBL
Match: V7B3N9_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_008G113200g PE=4 SV=1) HSP 1 Score: 137.1 bits (344), Expect = 1.6e-29 Identity = 73/131 (55.73%), Postives = 87/131 (66.41%), Query Frame = 1
BLAST of Cp4.1LG10g08200 vs. TrEMBL
Match: B9HC67_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0006s09430g PE=4 SV=2) HSP 1 Score: 136.7 bits (343), Expect = 2.1e-29 Identity = 74/130 (56.92%), Postives = 96/130 (73.85%), Query Frame = 1
BLAST of Cp4.1LG10g08200 vs. TrEMBL
Match: A0A059D5N5_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_B02737 PE=4 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 1.7e-28 Identity = 67/132 (50.76%), Postives = 96/132 (72.73%), Query Frame = 1
BLAST of Cp4.1LG10g08200 vs. TrEMBL
Match: I3T3C3_MEDTR (Ctr family copper transporter OS=Medicago truncatula GN=MTR_7g066070 PE=2 SV=1) HSP 1 Score: 131.7 bits (330), Expect = 6.6e-28 Identity = 72/133 (54.14%), Postives = 88/133 (66.17%), Query Frame = 1
BLAST of Cp4.1LG10g08200 vs. TAIR10
Match: AT3G46900.1 (AT3G46900.1 copper transporter 2) HSP 1 Score: 104.4 bits (259), Expect = 5.7e-23 Identity = 61/126 (48.41%), Postives = 79/126 (62.70%), Query Frame = 1
BLAST of Cp4.1LG10g08200 vs. TAIR10
Match: AT2G26975.1 (AT2G26975.1 Ctr copper transporter family) HSP 1 Score: 101.3 bits (251), Expect = 4.9e-22 Identity = 55/119 (46.22%), Postives = 76/119 (63.87%), Query Frame = 1
BLAST of Cp4.1LG10g08200 vs. TAIR10
Match: AT5G59030.1 (AT5G59030.1 copper transporter 1) HSP 1 Score: 100.1 bits (248), Expect = 1.1e-21 Identity = 53/105 (50.48%), Postives = 69/105 (65.71%), Query Frame = 1
BLAST of Cp4.1LG10g08200 vs. TAIR10
Match: AT2G37925.1 (AT2G37925.1 copper transporter 4) HSP 1 Score: 89.7 bits (221), Expect = 1.5e-18 Identity = 48/110 (43.64%), Postives = 68/110 (61.82%), Query Frame = 1
BLAST of Cp4.1LG10g08200 vs. TAIR10
Match: AT5G59040.1 (AT5G59040.1 copper transporter 3) HSP 1 Score: 89.4 bits (220), Expect = 1.9e-18 Identity = 51/119 (42.86%), Postives = 68/119 (57.14%), Query Frame = 1
BLAST of Cp4.1LG10g08200 vs. NCBI nr
Match: gi|659069210|ref|XP_008448687.1| (PREDICTED: copper transporter 2-like [Cucumis melo]) HSP 1 Score: 199.5 bits (506), Expect = 3.7e-48 Identity = 104/151 (68.87%), Postives = 121/151 (80.13%), Query Frame = 1
BLAST of Cp4.1LG10g08200 vs. NCBI nr
Match: gi|778693610|ref|XP_011653663.1| (PREDICTED: copper transporter 2-like [Cucumis sativus]) HSP 1 Score: 194.9 bits (494), Expect = 9.2e-47 Identity = 106/150 (70.67%), Postives = 125/150 (83.33%), Query Frame = 1
BLAST of Cp4.1LG10g08200 vs. NCBI nr
Match: gi|593414155|ref|XP_007140450.1| (hypothetical protein PHAVU_008G113200g [Phaseolus vulgaris]) HSP 1 Score: 137.1 bits (344), Expect = 2.3e-29 Identity = 73/131 (55.73%), Postives = 87/131 (66.41%), Query Frame = 1
BLAST of Cp4.1LG10g08200 vs. NCBI nr
Match: gi|702274111|ref|XP_010044028.1| (PREDICTED: copper transporter 1-like [Eucalyptus grandis]) HSP 1 Score: 137.1 bits (344), Expect = 2.3e-29 Identity = 69/133 (51.88%), Postives = 97/133 (72.93%), Query Frame = 1
BLAST of Cp4.1LG10g08200 vs. NCBI nr
Match: gi|566175385|ref|XP_002309099.2| (hypothetical protein POPTR_0006s09430g [Populus trichocarpa]) HSP 1 Score: 136.7 bits (343), Expect = 3.0e-29 Identity = 74/130 (56.92%), Postives = 96/130 (73.85%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |