Cp4.1LG10g04870 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGAAGGATATTGAAGCCGGAGGGCGTGGTGGGTTTAGCGGCAAGGATTACCAAGACCCGCCGGCAGCGCCATTGATCGACGCACAGGAGTTTGCTCAGTGGTCATTTTACCGAGCCATTATAGCCGAGTTTGTTGCTACCCTTTTGTTCTTGTATGTCACTGTTCTCACTGTCATTGGGTATAAAGTTCAGAGTGATGTTGACAATGGAGGCCAGATTTGCGGCGGCGTCGGCATTTTGGGCATCGCTTGGGCCTTCGGCGGCATGATTTTTGTACTCGTTTACTGCACCGCCGGTATTTCCGGTGAGTTCAATGAATCAAATAGGGCAAGATTAATTTAA ATGTCGAAGGATATTGAAGCCGGAGGGCGTGGTGGGTTTAGCGGCAAGGATTACCAAGACCCGCCGGCAGCGCCATTGATCGACGCACAGGAGTTTGCTCAGTGGTCATTTTACCGAGCCATTATAGCCGAGTTTGTTGCTACCCTTTTGTTCTTGTATGTCACTGTTCTCACTGTCATTGGGTATAAAGTTCAGAGTGATGTTGACAATGGAGGCCAGATTTGCGGCGGCGTCGGCATTTTGGGCATCGCTTGGGCCTTCGGCGGCATGATTTTTGTACTCGTTTACTGCACCGCCGGTATTTCCGGTGAGTTCAATGAATCAAATAGGGCAAGATTAATTTAA ATGTCGAAGGATATTGAAGCCGGAGGGCGTGGTGGGTTTAGCGGCAAGGATTACCAAGACCCGCCGGCAGCGCCATTGATCGACGCACAGGAGTTTGCTCAGTGGTCATTTTACCGAGCCATTATAGCCGAGTTTGTTGCTACCCTTTTGTTCTTGTATGTCACTGTTCTCACTGTCATTGGGTATAAAGTTCAGAGTGATGTTGACAATGGAGGCCAGATTTGCGGCGGCGTCGGCATTTTGGGCATCGCTTGGGCCTTCGGCGGCATGATTTTTGTACTCGTTTACTGCACCGCCGGTATTTCCGGTGAGTTCAATGAATCAAATAGGGCAAGATTAATTTAA MSKDIEAGGRGGFSGKDYQDPPAAPLIDAQEFAQWSFYRAIIAEFVATLLFLYVTVLTVIGYKVQSDVDNGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGEFNESNRARLI
BLAST of Cp4.1LG10g04870 vs. Swiss-Prot
Match: PIP21_ARATH (Aquaporin PIP2-1 OS=Arabidopsis thaliana GN=PIP2-1 PE=1 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 2.0e-39 Identity = 79/103 (76.70%), Postives = 87/103 (84.47%), Query Frame = 1
BLAST of Cp4.1LG10g04870 vs. Swiss-Prot
Match: PIP23_ARATH (Aquaporin PIP2-3 OS=Arabidopsis thaliana GN=PIP2-3 PE=1 SV=1) HSP 1 Score: 155.6 bits (392), Expect = 3.2e-37 Identity = 76/103 (73.79%), Postives = 85/103 (82.52%), Query Frame = 1
BLAST of Cp4.1LG10g04870 vs. Swiss-Prot
Match: PIP22_ARATH (Aquaporin PIP2-2 OS=Arabidopsis thaliana GN=PIP2-2 PE=1 SV=2) HSP 1 Score: 154.1 bits (388), Expect = 9.4e-37 Identity = 75/103 (72.82%), Postives = 84/103 (81.55%), Query Frame = 1
BLAST of Cp4.1LG10g04870 vs. Swiss-Prot
Match: PIP24_MAIZE (Aquaporin PIP2-4 OS=Zea mays GN=PIP2-4 PE=1 SV=1) HSP 1 Score: 153.7 bits (387), Expect = 1.2e-36 Identity = 79/107 (73.83%), Postives = 86/107 (80.37%), Query Frame = 1
BLAST of Cp4.1LG10g04870 vs. Swiss-Prot
Match: PIP23_MAIZE (Aquaporin PIP2-3 OS=Zea mays GN=PIP2-3 PE=2 SV=1) HSP 1 Score: 146.4 bits (368), Expect = 2.0e-34 Identity = 76/105 (72.38%), Postives = 83/105 (79.05%), Query Frame = 1
BLAST of Cp4.1LG10g04870 vs. TrEMBL
Match: V5RDL5_CUCSA (Plasma intrinsic protein 2-1 OS=Cucumis sativus GN=PIP2-1 PE=2 SV=1) HSP 1 Score: 188.3 bits (477), Expect = 5.0e-45 Identity = 93/103 (90.29%), Postives = 95/103 (92.23%), Query Frame = 1
BLAST of Cp4.1LG10g04870 vs. TrEMBL
Match: Q84XC6_9ROSI (Plasma intrinsic protein 2,2 OS=Juglans regia PE=2 SV=1) HSP 1 Score: 176.8 bits (447), Expect = 1.5e-41 Identity = 86/103 (83.50%), Postives = 92/103 (89.32%), Query Frame = 1
BLAST of Cp4.1LG10g04870 vs. TrEMBL
Match: Q84XC7_9ROSI (Plasma intrinsic protein 2,1 OS=Juglans regia PE=2 SV=1) HSP 1 Score: 176.8 bits (447), Expect = 1.5e-41 Identity = 86/103 (83.50%), Postives = 92/103 (89.32%), Query Frame = 1
BLAST of Cp4.1LG10g04870 vs. TrEMBL
Match: V5RDW7_CUCSA (Plasma intrinsic protein 2-3 OS=Cucumis sativus GN=PIP2-3 PE=2 SV=1) HSP 1 Score: 175.3 bits (443), Expect = 4.4e-41 Identity = 89/103 (86.41%), Postives = 92/103 (89.32%), Query Frame = 1
BLAST of Cp4.1LG10g04870 vs. TrEMBL
Match: I3T4F8_LOTJA (Uncharacterized protein OS=Lotus japonicus PE=2 SV=1) HSP 1 Score: 174.9 bits (442), Expect = 5.7e-41 Identity = 83/103 (80.58%), Postives = 91/103 (88.35%), Query Frame = 1
BLAST of Cp4.1LG10g04870 vs. TAIR10
Match: AT3G53420.1 (AT3G53420.1 plasma membrane intrinsic protein 2A) HSP 1 Score: 162.9 bits (411), Expect = 1.1e-40 Identity = 79/103 (76.70%), Postives = 87/103 (84.47%), Query Frame = 1
BLAST of Cp4.1LG10g04870 vs. TAIR10
Match: AT2G37180.1 (AT2G37180.1 Aquaporin-like superfamily protein) HSP 1 Score: 155.6 bits (392), Expect = 1.8e-38 Identity = 76/103 (73.79%), Postives = 85/103 (82.52%), Query Frame = 1
BLAST of Cp4.1LG10g04870 vs. TAIR10
Match: AT2G37170.1 (AT2G37170.1 plasma membrane intrinsic protein 2) HSP 1 Score: 154.1 bits (388), Expect = 5.3e-38 Identity = 75/103 (72.82%), Postives = 84/103 (81.55%), Query Frame = 1
BLAST of Cp4.1LG10g04870 vs. TAIR10
Match: AT5G60660.1 (AT5G60660.1 plasma membrane intrinsic protein 2;4) HSP 1 Score: 146.0 bits (367), Expect = 1.4e-35 Identity = 70/103 (67.96%), Postives = 82/103 (79.61%), Query Frame = 1
BLAST of Cp4.1LG10g04870 vs. TAIR10
Match: AT3G54820.1 (AT3G54820.1 plasma membrane intrinsic protein 2;5) HSP 1 Score: 145.2 bits (365), Expect = 2.5e-35 Identity = 71/103 (68.93%), Postives = 83/103 (80.58%), Query Frame = 1
BLAST of Cp4.1LG10g04870 vs. NCBI nr
Match: gi|659096721|ref|XP_008449251.1| (PREDICTED: aquaporin PIP2-1-like isoform X1 [Cucumis melo]) HSP 1 Score: 193.0 bits (489), Expect = 2.9e-46 Identity = 95/103 (92.23%), Postives = 98/103 (95.15%), Query Frame = 1
BLAST of Cp4.1LG10g04870 vs. NCBI nr
Match: gi|659096723|ref|XP_008449252.1| (PREDICTED: aquaporin PIP2-1-like isoform X2 [Cucumis melo]) HSP 1 Score: 193.0 bits (489), Expect = 2.9e-46 Identity = 95/103 (92.23%), Postives = 98/103 (95.15%), Query Frame = 1
BLAST of Cp4.1LG10g04870 vs. NCBI nr
Match: gi|566006178|ref|NP_001274386.1| (aquaporin PIP2-1-like [Cucumis sativus]) HSP 1 Score: 188.3 bits (477), Expect = 7.2e-45 Identity = 93/103 (90.29%), Postives = 95/103 (92.23%), Query Frame = 1
BLAST of Cp4.1LG10g04870 vs. NCBI nr
Match: gi|28395418|gb|AAO39007.1| (plasma intrinsic protein 2,1 [Juglans regia]) HSP 1 Score: 176.8 bits (447), Expect = 2.2e-41 Identity = 86/103 (83.50%), Postives = 92/103 (89.32%), Query Frame = 1
BLAST of Cp4.1LG10g04870 vs. NCBI nr
Match: gi|28395420|gb|AAO39008.1| (plasma intrinsic protein 2,2 [Juglans regia]) HSP 1 Score: 176.8 bits (447), Expect = 2.2e-41 Identity = 86/103 (83.50%), Postives = 92/103 (89.32%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |