Cp4.1LG10g04540 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGCGGAACCAGTGAGTGCCAAGCGGTAGTTTGTGCAGGAAATGTAAATGCAATTTGTCCACCGGAATTAGCCGTCAGAGGACAAGATGGTGCAGTGATCGCGTGTAAAAGTGCTTGTATGGCTTTCAATCAGCCGGAATTTTGTTGCTGCGGCAACCACAATCAGCCACAAACTTGCCCGCCGACGAACTATTCGAAGATGTTCAAGGATCAATGTCCCCAGGCTTATAGTTACGCTTACGATGATCAAACAAGTATCTTTACGTGCACGGCCGGAGCCAATTATGGCATCACTTTTTGTCCTTGA ATGGGCGGAACCAGTGAGTGCCAAGCGGTAGTTTGTGCAGGAAATGTAAATGCAATTTGTCCACCGGAATTAGCCGTCAGAGGACAAGATGGTGCAGTGATCGCGTGTAAAAGTGCTTGTATGGCTTTCAATCAGCCGGAATTTTGTTGCTGCGGCAACCACAATCAGCCACAAACTTGCCCGCCGACGAACTATTCGAAGATGTTCAAGGATCAATGTCCCCAGGCTTATAGTTACGCTTACGATGATCAAACAAGTATCTTTACGTGCACGGCCGGAGCCAATTATGGCATCACTTTTTGTCCTTGA ATGGGCGGAACCAGTGAGTGCCAAGCGGTAGTTTGTGCAGGAAATGTAAATGCAATTTGTCCACCGGAATTAGCCGTCAGAGGACAAGATGGTGCAGTGATCGCGTGTAAAAGTGCTTGTATGGCTTTCAATCAGCCGGAATTTTGTTGCTGCGGCAACCACAATCAGCCACAAACTTGCCCGCCGACGAACTATTCGAAGATGTTCAAGGATCAATGTCCCCAGGCTTATAGTTACGCTTACGATGATCAAACAAGTATCTTTACGTGCACGGCCGGAGCCAATTATGGCATCACTTTTTGTCCTTGA MGGTSECQAVVCAGNVNAICPPELAVRGQDGAVIACKSACMAFNQPEFCCCGNHNQPQTCPPTNYSKMFKDQCPQAYSYAYDDQTSIFTCTAGANYGITFCP
BLAST of Cp4.1LG10g04540 vs. Swiss-Prot
Match: TLP1_PYRPY (Thaumatin-like protein 1 OS=Pyrus pyrifolia GN=TL1 PE=1 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 1.4e-36 Identity = 62/101 (61.39%), Postives = 80/101 (79.21%), Query Frame = 1
BLAST of Cp4.1LG10g04540 vs. Swiss-Prot
Match: TLP1_CASSA (Thaumatin-like protein 1 OS=Castanea sativa GN=TL1 PE=2 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 3.5e-35 Identity = 63/101 (62.38%), Postives = 77/101 (76.24%), Query Frame = 1
BLAST of Cp4.1LG10g04540 vs. Swiss-Prot
Match: TLP1_PRUPE (Thaumatin-like protein 1 OS=Prunus persica PE=2 SV=1) HSP 1 Score: 146.4 bits (368), Expect = 1.8e-34 Identity = 61/101 (60.40%), Postives = 80/101 (79.21%), Query Frame = 1
BLAST of Cp4.1LG10g04540 vs. Swiss-Prot
Match: TLP_PRUAV (Glucan endo-1,3-beta-glucosidase OS=Prunus avium PE=1 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 3.3e-33 Identity = 58/101 (57.43%), Postives = 72/101 (71.29%), Query Frame = 1
BLAST of Cp4.1LG10g04540 vs. Swiss-Prot
Match: TP1A_MALDO (Thaumatin-like protein 1a OS=Malus domestica GN=TL1 PE=1 SV=1) HSP 1 Score: 140.2 bits (352), Expect = 1.3e-32 Identity = 59/101 (58.42%), Postives = 75/101 (74.26%), Query Frame = 1
BLAST of Cp4.1LG10g04540 vs. TrEMBL
Match: A0A0A0KXS6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G647340 PE=4 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 9.7e-40 Identity = 72/102 (70.59%), Postives = 87/102 (85.29%), Query Frame = 1
BLAST of Cp4.1LG10g04540 vs. TrEMBL
Match: B9S0C7_RICCO (Zeamatin, putative OS=Ricinus communis GN=RCOM_1353320 PE=4 SV=1) HSP 1 Score: 164.5 bits (415), Expect = 6.9e-38 Identity = 72/100 (72.00%), Postives = 82/100 (82.00%), Query Frame = 1
BLAST of Cp4.1LG10g04540 vs. TrEMBL
Match: A0A0A0KF73_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G448170 PE=4 SV=1) HSP 1 Score: 164.1 bits (414), Expect = 9.0e-38 Identity = 66/102 (64.71%), Postives = 89/102 (87.25%), Query Frame = 1
BLAST of Cp4.1LG10g04540 vs. TrEMBL
Match: A0A061EUA4_THECC (Thaumatin-like protein 1a OS=Theobroma cacao GN=TCM_022309 PE=4 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 2.0e-37 Identity = 71/101 (70.30%), Postives = 81/101 (80.20%), Query Frame = 1
BLAST of Cp4.1LG10g04540 vs. TrEMBL
Match: M5WH78_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa010031mg PE=4 SV=1) HSP 1 Score: 162.5 bits (410), Expect = 2.6e-37 Identity = 67/101 (66.34%), Postives = 81/101 (80.20%), Query Frame = 1
BLAST of Cp4.1LG10g04540 vs. TAIR10
Match: AT1G19320.1 (AT1G19320.1 Pathogenesis-related thaumatin superfamily protein) HSP 1 Score: 136.3 bits (342), Expect = 1.0e-32 Identity = 63/100 (63.00%), Postives = 74/100 (74.00%), Query Frame = 1
BLAST of Cp4.1LG10g04540 vs. TAIR10
Match: AT1G75030.1 (AT1G75030.1 thaumatin-like protein 3) HSP 1 Score: 130.2 bits (326), Expect = 7.3e-31 Identity = 61/102 (59.80%), Postives = 71/102 (69.61%), Query Frame = 1
BLAST of Cp4.1LG10g04540 vs. TAIR10
Match: AT1G75050.1 (AT1G75050.1 Pathogenesis-related thaumatin superfamily protein) HSP 1 Score: 129.4 bits (324), Expect = 1.3e-30 Identity = 61/102 (59.80%), Postives = 70/102 (68.63%), Query Frame = 1
BLAST of Cp4.1LG10g04540 vs. TAIR10
Match: AT1G75040.1 (AT1G75040.1 pathogenesis-related gene 5) HSP 1 Score: 129.4 bits (324), Expect = 1.3e-30 Identity = 58/101 (57.43%), Postives = 76/101 (75.25%), Query Frame = 1
BLAST of Cp4.1LG10g04540 vs. TAIR10
Match: AT1G73620.1 (AT1G73620.1 Pathogenesis-related thaumatin superfamily protein) HSP 1 Score: 123.2 bits (308), Expect = 9.0e-29 Identity = 58/101 (57.43%), Postives = 70/101 (69.31%), Query Frame = 1
BLAST of Cp4.1LG10g04540 vs. NCBI nr
Match: gi|659119175|ref|XP_008459514.1| (PREDICTED: thaumatin-like protein 1b [Cucumis melo]) HSP 1 Score: 175.3 bits (443), Expect = 5.6e-41 Identity = 76/102 (74.51%), Postives = 88/102 (86.27%), Query Frame = 1
BLAST of Cp4.1LG10g04540 vs. NCBI nr
Match: gi|449447717|ref|XP_004141614.1| (PREDICTED: thaumatin-like protein 1b [Cucumis sativus]) HSP 1 Score: 170.6 bits (431), Expect = 1.4e-39 Identity = 72/102 (70.59%), Postives = 87/102 (85.29%), Query Frame = 1
BLAST of Cp4.1LG10g04540 vs. NCBI nr
Match: gi|470123658|ref|XP_004297839.1| (PREDICTED: thaumatin-like protein 1 [Fragaria vesca subsp. vesca]) HSP 1 Score: 167.9 bits (424), Expect = 9.0e-39 Identity = 69/101 (68.32%), Postives = 84/101 (83.17%), Query Frame = 1
BLAST of Cp4.1LG10g04540 vs. NCBI nr
Match: gi|1009160841|ref|XP_015898569.1| (PREDICTED: thaumatin-like protein 1b [Ziziphus jujuba]) HSP 1 Score: 166.4 bits (420), Expect = 2.6e-38 Identity = 69/101 (68.32%), Postives = 86/101 (85.15%), Query Frame = 1
BLAST of Cp4.1LG10g04540 vs. NCBI nr
Match: gi|255556826|ref|XP_002519446.1| (PREDICTED: thaumatin-like protein 1 [Ricinus communis]) HSP 1 Score: 164.5 bits (415), Expect = 9.9e-38 Identity = 72/100 (72.00%), Postives = 82/100 (82.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|