Cp4.1LG10g04040 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTTTCTGCCATGAATTTGTTTCAAAAGGCACCTGAAAGAGATATCGTGGCATTGTCGGCTTTGATATCTGGGTATACACGAAATCGTCAGCCAAATGAGGCTGTCAAAACTTTTCTTGAAATGGGTTCTAGGAATGTGAAATCTGATGAGTTTCTATTGGCAAGCTTTATGTCAGCTTGTTCTCACGTGGGTTGATTCATATGTTACCAAGTGCTTAGTTGATCTTTGTGGGGCTCATGTTAGGGCAGCTCTTAAAGATATGAATGCCAAGTGTGGAAACATGAAGCGAGCCATGAATCTGTTTGAAGAAATGCCTAAAAGGGATCTAATTCCCTGTTGTTCTGCAATGTAA ATGCTTTCTGCCATGAATTTGTTTCAAAAGGCACCTGAAAGAGATATCGTGGCATTGTCGGCTTTGATATCTGGGTATACACGAAATCGTCAGCCAAATGAGGCTGTCAAAACTTTTCTTGAAATGGGTTCTAGGAATGTGAAATCTGATGAGTTTCTATTGGCAAGCTTTATGGCAGCTCTTAAAGATATGAATGCCAAGTGTGGAAACATGAAGCGAGCCATGAATCTGTTTGAAGAAATGCCTAAAAGGGATCTAATTCCCTGTTGTTCTGCAATGTAA ATGCTTTCTGCCATGAATTTGTTTCAAAAGGCACCTGAAAGAGATATCGTGGCATTGTCGGCTTTGATATCTGGGTATACACGAAATCGTCAGCCAAATGAGGCTGTCAAAACTTTTCTTGAAATGGGTTCTAGGAATGTGAAATCTGATGAGTTTCTATTGGCAAGCTTTATGGCAGCTCTTAAAGATATGAATGCCAAGTGTGGAAACATGAAGCGAGCCATGAATCTGTTTGAAGAAATGCCTAAAAGGGATCTAATTCCCTGTTGTTCTGCAATGTAA MLSAMNLFQKAPERDIVALSALISGYTRNRQPNEAVKTFLEMGSRNVKSDEFLLASFMAALKDMNAKCGNMKRAMNLFEEMPKRDLIPCCSAM
BLAST of Cp4.1LG10g04040 vs. Swiss-Prot
Match: PP403_ARATH (Putative pentatricopeptide repeat-containing protein At5g37570 OS=Arabidopsis thaliana GN=PCMP-E37 PE=3 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 1.6e-18 Identity = 55/125 (44.00%), Postives = 69/125 (55.20%), Query Frame = 1
BLAST of Cp4.1LG10g04040 vs. Swiss-Prot
Match: PP219_ARATH (Putative pentatricopeptide repeat-containing protein At3g08820 OS=Arabidopsis thaliana GN=PCMP-H84 PE=3 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 6.8e-09 Identity = 36/118 (30.51%), Postives = 54/118 (45.76%), Query Frame = 1
BLAST of Cp4.1LG10g04040 vs. Swiss-Prot
Match: PP330_ARATH (Pentatricopeptide repeat-containing protein At4g21065 OS=Arabidopsis thaliana GN=PCMP-H28 PE=2 SV=2) HSP 1 Score: 60.5 bits (145), Expect = 1.2e-08 Identity = 33/116 (28.45%), Postives = 57/116 (49.14%), Query Frame = 1
BLAST of Cp4.1LG10g04040 vs. Swiss-Prot
Match: PP185_ARATH (Pentatricopeptide repeat-containing protein At2g35030, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E15 PE=2 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 3.7e-07 Identity = 28/81 (34.57%), Postives = 51/81 (62.96%), Query Frame = 1
BLAST of Cp4.1LG10g04040 vs. Swiss-Prot
Match: PP200_ARATH (Pentatricopeptide repeat-containing protein At2g42920, chloroplastic OS=Arabidopsis thaliana GN=PCMP-E75 PE=2 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 6.3e-07 Identity = 36/121 (29.75%), Postives = 58/121 (47.93%), Query Frame = 1
BLAST of Cp4.1LG10g04040 vs. TrEMBL
Match: A0A0A0KKK4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G454340 PE=4 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 5.9e-28 Identity = 75/125 (60.00%), Postives = 81/125 (64.80%), Query Frame = 1
BLAST of Cp4.1LG10g04040 vs. TrEMBL
Match: B9HBW1_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0006s22400g PE=4 SV=2) HSP 1 Score: 113.2 bits (282), Expect = 1.7e-22 Identity = 61/123 (49.59%), Postives = 74/123 (60.16%), Query Frame = 1
BLAST of Cp4.1LG10g04040 vs. TrEMBL
Match: F6HKN9_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_08s0007g02780 PE=4 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 2.2e-22 Identity = 65/125 (52.00%), Postives = 74/125 (59.20%), Query Frame = 1
BLAST of Cp4.1LG10g04040 vs. TrEMBL
Match: B9SWZ6_RICCO (Pentatricopeptide repeat-containing protein, putative OS=Ricinus communis GN=RCOM_1258590 PE=4 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 2.2e-22 Identity = 62/123 (50.41%), Postives = 76/123 (61.79%), Query Frame = 1
BLAST of Cp4.1LG10g04040 vs. TrEMBL
Match: M5VLF1_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa024189mg PE=4 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 2.4e-21 Identity = 62/123 (50.41%), Postives = 74/123 (60.16%), Query Frame = 1
BLAST of Cp4.1LG10g04040 vs. TAIR10
Match: AT5G37570.1 (AT5G37570.1 Pentatricopeptide repeat (PPR-like) superfamily protein) HSP 1 Score: 93.2 bits (230), Expect = 9.1e-20 Identity = 55/125 (44.00%), Postives = 69/125 (55.20%), Query Frame = 1
BLAST of Cp4.1LG10g04040 vs. TAIR10
Match: AT3G08820.1 (AT3G08820.1 Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 61.2 bits (147), Expect = 3.8e-10 Identity = 36/118 (30.51%), Postives = 54/118 (45.76%), Query Frame = 1
BLAST of Cp4.1LG10g04040 vs. TAIR10
Match: AT4G21065.1 (AT4G21065.1 Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 60.5 bits (145), Expect = 6.5e-10 Identity = 33/116 (28.45%), Postives = 57/116 (49.14%), Query Frame = 1
BLAST of Cp4.1LG10g04040 vs. TAIR10
Match: AT2G35030.1 (AT2G35030.1 Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 55.5 bits (132), Expect = 2.1e-08 Identity = 28/81 (34.57%), Postives = 51/81 (62.96%), Query Frame = 1
BLAST of Cp4.1LG10g04040 vs. TAIR10
Match: AT2G42920.1 (AT2G42920.1 Pentatricopeptide repeat (PPR-like) superfamily protein) HSP 1 Score: 54.7 bits (130), Expect = 3.6e-08 Identity = 36/121 (29.75%), Postives = 58/121 (47.93%), Query Frame = 1
BLAST of Cp4.1LG10g04040 vs. NCBI nr
Match: gi|778717583|ref|XP_004143391.2| (PREDICTED: putative pentatricopeptide repeat-containing protein At5g37570 [Cucumis sativus]) HSP 1 Score: 131.3 bits (329), Expect = 8.5e-28 Identity = 75/125 (60.00%), Postives = 81/125 (64.80%), Query Frame = 1
BLAST of Cp4.1LG10g04040 vs. NCBI nr
Match: gi|700193082|gb|KGN48286.1| (hypothetical protein Csa_6G454340 [Cucumis sativus]) HSP 1 Score: 131.3 bits (329), Expect = 8.5e-28 Identity = 75/125 (60.00%), Postives = 81/125 (64.80%), Query Frame = 1
BLAST of Cp4.1LG10g04040 vs. NCBI nr
Match: gi|659125276|ref|XP_008462604.1| (PREDICTED: putative pentatricopeptide repeat-containing protein At5g37570 [Cucumis melo]) HSP 1 Score: 128.6 bits (322), Expect = 5.5e-27 Identity = 73/125 (58.40%), Postives = 79/125 (63.20%), Query Frame = 1
BLAST of Cp4.1LG10g04040 vs. NCBI nr
Match: gi|566177580|ref|XP_002309408.2| (hypothetical protein POPTR_0006s22400g [Populus trichocarpa]) HSP 1 Score: 113.2 bits (282), Expect = 2.4e-22 Identity = 61/123 (49.59%), Postives = 74/123 (60.16%), Query Frame = 1
BLAST of Cp4.1LG10g04040 vs. NCBI nr
Match: gi|223529919|gb|EEF31847.1| (pentatricopeptide repeat-containing protein, putative [Ricinus communis]) HSP 1 Score: 112.8 bits (281), Expect = 3.1e-22 Identity = 62/123 (50.41%), Postives = 76/123 (61.79%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |